Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.51
PubTator Score 23.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.341 7.3e-08
adult high grade glioma -1.500 1.8e-03
atypical teratoid / rhabdoid tumor -2.100 9.8e-08
glioblastoma -1.200 3.3e-04
medulloblastoma -1.200 1.3e-03
medulloblastoma, large-cell -2.000 6.6e-07
mucosa-associated lymphoid tissue lympho... 1.397 1.1e-02
osteosarcoma -1.385 5.3e-05
primitive neuroectodermal tumor -1.400 1.6e-03
subependymal giant cell astrocytoma -1.441 1.5e-02

Gene RIF (13)

AA Sequence

MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVP      1 - 70
QGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPS     71 - 140
GAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKD    141 - 210
MPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSS    211 - 280
LPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQC    281 - 350
SAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG    351 - 420
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTS    421 - 490
TTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTV    491 - 560
TAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPT    561 - 630
VTTISEPYIIQTHTKDKVQETQI                                                   631 - 653
//

Text Mined References (25)

PMID Year Title