Property Summary

NCBI Gene PubMed Count 23
Grant Count 6
R01 Count 6
Funding $301,425
PubMed Score 23.06
PubTator Score 23.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (12)

PMID Text
24563334 polymorphisms and haplotypes in the LRRC4 may have a role in pituitary adenoma in a Chinese population
24404152 Disturbing miR-182 and -381 inhibits BRD7 transcription and glioma growth by directly targeting LRRC4.
22834685 LRRC4 inhibited the miR-185 pathway function in glioma
21809374 Potentially, modulation of LRRC4 or STMN1 expression may be useful for design of new therapies for the intervention of glioma
21435336 As a glioma suppressor, LRRC4 inhibits the endogenous expression of small regulatory microRNA hsa-miR-381 and decreases cell proliferation and tumor growth in cultured glioma cells.
18976507 Methylation-mediated inactivation of LRRC4 is a frequent and glioma-specific event.
17541939 LRRC4 inhibits glioblastoma cell proliferation, migration, and angiogenesis by downgrading pleiotropic cytokine responses.
16941076 LRRC4 may be a negative regulator of the RPTP-zeta receptor, and contribute to suppressing the invasion ability of gliomas cells
16723503 LRRC4 plays a major role in suppressing U251 cell proliferation by regulating the extracellular signal-regulated kinase (ERK)/Akt/NF-kappaBp65, STAT3, and JNK2/c-Jun pathways.
16215635 these studies represent the first cDNA array analysis of the effects of LRRC4 on the involvement of different neurobiological genes in U251MG glioblastoma cells and provide new insights into the function of LRRC4 in glioma
More...

AA Sequence

MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVP      1 - 70
QGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPS     71 - 140
GAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKD    141 - 210
MPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSS    211 - 280
LPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQC    281 - 350
SAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG    351 - 420
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTS    421 - 490
TTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTV    491 - 560
TAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPT    561 - 630
VTTISEPYIIQTHTKDKVQETQI                                                   631 - 653
//

Text Mined References (24)

PMID Year Title
24563334 2014 LRRC4 haplotypes are associated with pituitary adenoma in a Chinese population.
24404152 2014 Disturbing miR-182 and -381 inhibits BRD7 transcription and glioma growth by directly targeting LRRC4.
22834685 2012 LRRC4 inhibits glioma cell growth and invasion through a miR-185-dependent pathway.
21946559 2011 Structural basis for cell surface patterning through NetrinG-NGL interactions.
21809374 2011 LRRC4 inhibits the proliferation of human glioma cells by modulating the expression of STMN1 and microtubule polymerization.
21435336 2011 Interaction of hsa-miR-381 and glioma suppressor LRRC4 is involved in glioma growth.
18976507 2008 Promoter hypermethylation-mediated inactivation of LRRC4 in gliomas.
17541939 2008 LRRC4 inhibits glioblastoma cell proliferation, migration, and angiogenesis by downregulating pleiotropic cytokine expression and responses.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16941076 2006 LRRC4 controls in vitro invasion of glioblastoma cells through inhibiting RPTP-zeta expression.
More...