1. Home
  2. Targets
  3. membrane traffic protein
  4. Putative golgin subfamily A member 2B

Tdark Putative golgin subfamily A member 2B


 Comments

Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 8.88949356913849E-10
ovarian cancer 8492 2.90145462406855E-9
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00101154042026309
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00153732572634176
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00302976003385342
adrenocortical carcinoma 1427 0.00342146686449659
ependymoma 2514 0.0165843962431678
invasive ductal carcinoma 2950 0.0182882673325086
active ulcerative colitis 477 0.0420752717851916

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 2.300 0.017
osteosarcoma -2.979 0.000
adrenocortical carcinoma 1.028 0.003
intraductal papillary-mucinous adenoma (... 1.200 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.003
intraductal papillary-mucinous neoplasm ... 1.300 0.002
active ulcerative colitis -1.138 0.042
invasive ductal carcinoma 1.200 0.018
ovarian cancer -1.300 0.000

Synonym

Accession Q9HBQ8 Q9NSV2
Symbols GOLGA2B
GOLGA2L1

Gene

GOLGA2P5

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

Pathway (1)

 UniProt Keyword (4)

AA Sequence 

MDSEEEEEVPQPMPSIPEDLESQKAMVAFFNSAVASAEEEQARLCGQLKECTASAWLICWPRPRRNLRQQ      1 - 70
PQPQELGVIPCVGRPTRPCRGPWRSCGRVHRTVPEPEGSAEGGGVHQQAGPGQGRGEGEAAGAGVACGRL     71 - 140
QQVA                                                                      141 - 144
//

Text Mined References (9)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.