Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 8.88949356913849E-10
ovarian cancer 8492 2.90145462406855E-9
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00101154042026309
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00153732572634176
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00302976003385342
adrenocortical carcinoma 1427 0.00342146686449659
ependymoma 2514 0.0165843962431678
invasive ductal carcinoma 2950 0.0182882673325086
active ulcerative colitis 477 0.0420752717851916

Synonym

Accession Q9HBQ8 Q9NSV2
Symbols GOLGA2B
GOLGA2L1

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSEEEEEVPQPMPSIPEDLESQKAMVAFFNSAVASAEEEQARLCGQLKECTASAWLICWPRPRRNLRQQ      1 - 70
PQPQELGVIPCVGRPTRPCRGPWRSCGRVHRTVPEPEGSAEGGGVHQQAGPGQGRGEGEAAGAGVACGRL     71 - 140
QQVA                                                                      141 - 144
//

Text Mined References (9)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.