Property Summary

NCBI Gene PubMed Count 20
PubMed Score 32.36
PubTator Score 15.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTALGDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEIS      1 - 70
HVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAIRMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSV     71 - 140
PIWIIIFGVIFCIIIVAIALLILSGIWQRRRKNKEPSEVDDAEDKCENMITIENGIPSDPLDMKGGHIND    141 - 210
AFMTEDERLTPL                                                              211 - 222
//

Text Mined References (21)

PMID Year Title