Property Summary

NCBI Gene PubMed Count 28
PubMed Score 50.40
PubTator Score 41.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.10057330234707E-15
medulloblastoma, large-cell 6234 4.6197975348735E-4
osteosarcoma 7933 0.0237377985824325
Disease Target Count Z-score Confidence
pre-eclampsia 67 3.552 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.202 0.024
medulloblastoma, large-cell 1.200 0.000
psoriasis -1.600 0.000

Synonym

Accession Q9HBJ0
Symbols CT92
OOSP2L

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (23)

PMID Text
26157147 PLAC1/CP1 provides a marker for identifying gastric cancers with poor prognosis, and suggest that PLAC1/CP1 may provide a useful target for immunotherapy.
25138310 circulating mRNA improved detection rate of pre-eclampsia
24989904 Data suggests that PLAC1 plays an important role in human placental trophoblast invasion and migration.
24912876 This data suggests that the Epstein-Barr virus-induced PLAC1 is a member of the cancer/testis group of tumor antigens.
24304549 NCOA3 is a selective co-activator of estrogen receptor alpha-mediated transactivation of PLAC1.
23604623 PLAC1/CP1 antigen is a possible prognostic marker of colorectal carcinoma, and PLAC1/CP1 p41-50 and PLAC1/CP1 p69-77 are novel HLA-A*0201-restricted CD8+ T cell epitopes
23434395 we identified a novel specific antitrophoblast antibody, anti-PLAC1, in infertile women with repeated unexplained implantation failure. PLAC1 shows placenta-specific expression and is localized primarily in the syncytiotrophoblast.
21937108 RXRalpha and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21710262 A novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 has been identified in breast cancer.
21215095 The expression of PLAC1/CP1 genes correlates with various clinical and pathologic parameters in primary colorectal carcinoma.
More...

AA Sequence

MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHA      1 - 70
YQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATA     71 - 140
QKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIG    141 - 210
SM                                                                        211 - 212
//

Text Mined References (28)

PMID Year Title
26157147 2015 New tumour antigen PLAC1/CP1, a potentially useful prognostic marker and immunotherapy target for gastric adenocarcinoma.
25138310 2014 Circulating mRNA for the PLAC1 gene as a second trimester marker (14-18 weeks' gestation) in the screening for late preeclampsia.
24989904 2014 Role of placenta-specific protein 1 in trophoblast invasion and migration.
24912876 2014 The placental specific gene, PLAC1, is induced by the Epstein-Barr virus and is expressed in human tumor cells.
24304549 2013 NCOA3 is a selective co-activator of estrogen receptor ?-mediated transactivation of PLAC1 in MCF-7 breast cancer cells.
23604623 2014 Identification of two new HLA-A*0201-restricted cytotoxic T lymphocyte epitopes from colorectal carcinoma-associated antigen PLAC1/CP1.
23434395 2013 Preliminary evidence for high anti-PLAC1 antibody levels in infertile patients with repeated unexplained implantation failure.
21937108 2011 RXR? and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21710262 2012 Identification of a novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 in breast cancer.
21215095 2010 [Expression of PLAC1/CP1 genes in primary colorectal carcinoma and its clinical significance].
More...