Property Summary

NCBI Gene PubMed Count 33
PubMed Score 57.38
PubTator Score 41.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.1e-15
medulloblastoma, large-cell 6241 4.6e-04
osteosarcoma 7950 2.4e-02
Disease Target Count Z-score Confidence
Pre-Eclampsia 68 3.44 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 4.6e-04
osteosarcoma 1.202 2.4e-02
psoriasis -1.600 1.1e-15

Synonym

Accession Q9HBJ0
Symbols CT92
OOSP2L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (28)

AA Sequence

MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHA      1 - 70
YQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATA     71 - 140
QKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIG    141 - 210
SM                                                                        211 - 212
//

Text Mined References (33)

PMID Year Title