Property Summary

NCBI Gene PubMed Count 28
Grant Count 14
Funding $1,439,797.17
PubMed Score 50.40
PubTator Score 41.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.202 0.024
medulloblastoma, large-cell 1.200 0.000
psoriasis -1.600 0.000

Gene RIF (23)

PMID Text
26157147 PLAC1/CP1 provides a marker for identifying gastric cancers with poor prognosis, and suggest that PLAC1/CP1 may provide a useful target for immunotherapy.
25138310 circulating mRNA improved detection rate of pre-eclampsia
24989904 Data suggests that PLAC1 plays an important role in human placental trophoblast invasion and migration.
24912876 This data suggests that the Epstein-Barr virus-induced PLAC1 is a member of the cancer/testis group of tumor antigens.
24304549 NCOA3 is a selective co-activator of estrogen receptor alpha-mediated transactivation of PLAC1.
23604623 PLAC1/CP1 antigen is a possible prognostic marker of colorectal carcinoma, and PLAC1/CP1 p41-50 and PLAC1/CP1 p69-77 are novel HLA-A*0201-restricted CD8+ T cell epitopes
23434395 we identified a novel specific antitrophoblast antibody, anti-PLAC1, in infertile women with repeated unexplained implantation failure. PLAC1 shows placenta-specific expression and is localized primarily in the syncytiotrophoblast.
21937108 RXRalpha and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21710262 A novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 has been identified in breast cancer.
21215095 The expression of PLAC1/CP1 genes correlates with various clinical and pathologic parameters in primary colorectal carcinoma.
More...

AA Sequence

MKVFKFIGLMILLTSAFSAGSGQSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHA      1 - 70
YQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATA     71 - 140
QKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIG    141 - 210
SM                                                                        211 - 212
//

Text Mined References (28)

PMID Year Title
26157147 2015 New tumour antigen PLAC1/CP1, a potentially useful prognostic marker and immunotherapy target for gastric adenocarcinoma.
25138310 2014 Circulating mRNA for the PLAC1 gene as a second trimester marker (14-18 weeks' gestation) in the screening for late preeclampsia.
24989904 2014 Role of placenta-specific protein 1 in trophoblast invasion and migration.
24912876 2014 The placental specific gene, PLAC1, is induced by the Epstein-Barr virus and is expressed in human tumor cells.
24304549 2013 NCOA3 is a selective co-activator of estrogen receptor ?-mediated transactivation of PLAC1 in MCF-7 breast cancer cells.
23604623 2014 Identification of two new HLA-A*0201-restricted cytotoxic T lymphocyte epitopes from colorectal carcinoma-associated antigen PLAC1/CP1.
23434395 2013 Preliminary evidence for high anti-PLAC1 antibody levels in infertile patients with repeated unexplained implantation failure.
21937108 2011 RXR? and LXR activate two promoters in placenta- and tumor-specific expression of PLAC1.
21710262 2012 Identification of a novel HLA-A2-restricted cytotoxic T lymphocyte epitope from cancer-testis antigen PLAC1 in breast cancer.
21215095 2010 [Expression of PLAC1/CP1 genes in primary colorectal carcinoma and its clinical significance].
More...