Property Summary

NCBI Gene PubMed Count 30
PubMed Score 43.81
PubTator Score 24.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.100 8.7e-03
atypical teratoid / rhabdoid tumor 1.200 2.1e-03
cutaneous lupus erythematosus 2.100 4.5e-03
dermatomyositis -1.100 6.5e-04
interstitial cystitis 1.800 7.6e-03
medulloblastoma, large-cell 1.400 5.0e-05
osteosarcoma -3.386 4.4e-07
ovarian cancer 1.300 2.7e-07
periodontitis 1.100 1.9e-21
ulcerative colitis 1.100 5.1e-04

Gene RIF (19)

AA Sequence

MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNIS      1 - 70
VDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEV     71 - 140
TTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVS    141 - 210
RTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKV    211 - 280
VWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMT    281 - 350
HVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE    351 - 420
NHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSS    421 - 490
QAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRY    491 - 560
EVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGENTMYAQVFNLQGKTPVSQKEESSATIYCSIR    561 - 630
KPQVVPPPQQNDLEIPESPTYENFT                                                 631 - 655
//

Text Mined References (34)

PMID Year Title