Property Summary

NCBI Gene PubMed Count 28
Grant Count 9
R01 Count 3
Funding $708,001.46
PubMed Score 41.91
PubTator Score 24.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.100 0.005
osteosarcoma -3.386 0.000
periodontitis 1.100 0.000
atypical teratoid / rhabdoid tumor 1.200 0.002
medulloblastoma, large-cell 1.400 0.000
interstitial cystitis 2.100 0.002
adult high grade glioma 1.100 0.009
ulcerative colitis 1.100 0.001
ovarian cancer 1.300 0.000
dermatomyositis -1.100 0.001

Gene RIF (16)

PMID Text
26303094 CD229 Expression on Bone Marrow Plasma Cells from Patients with Multiple Myeloma and Monoclonal Gammopathies of Uncertain Significance.
26221972 the Val602 variant of the non-synonymous single nucleotide polymorphism (SNP) rs509749 in the SLAM family member CD229 (Ly9, SLAMF3) has a two-fold lower affinity compared with the SLE-associated Met602 variant for the small adaptor protein SAP
26001047 study showed CD229 is overexpressed on the malignant plasma cells of patients across all types of plasma cell dyscrasias including multiple myeloma; CD229 is also expressed on the surface of a fraction of cells carrying the phenotype of chemotherapy-resistant and myeloma-propagating cells within the patients' bone marrow
24927415 Results revealed that SLAMF3 plays a role during hepatitis C virus entry, likely by enhancing entry of viral particle within hepatocytes.
24376606 SLAMF3 is an inhibitor of hepatocellular carcinoma cell proliferation and tumor progression.
24162774 HIV-1 gp120 downregulates the expression of lymphocyte antigen 9 (LY9) in human B cells
23956418 These results suggest a role for CD319 and CD229 in the systemic lupus erythematosus disease process.
22989874 Data indicate that the dominance of the SLAMF3/SLAMF6 pathway in inducing IL-17A production can be attributed to an increased nuclear abundance and recruitment of RORgammat to the IL17A promoter.
22184727 SLAMF3 and SLAMF6 T cell surface expression and IL-17 levels significantly correlate with disease activity in systemic lupus erythematosus patients
21606160 CD229 is specifically over-expressed on myeloma cells including their clonogenic precursors and contributes to their malignant phenotype.
More...

AA Sequence

MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNIS      1 - 70
VDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEV     71 - 140
TTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVS    141 - 210
RTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKV    211 - 280
VWLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMT    281 - 350
HVTLLIYRRLRKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE    351 - 420
NHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSS    421 - 490
QAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRY    491 - 560
EVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGENTMYAQVFNLQGKTPVSQKEESSATIYCSIR    561 - 630
KPQVVPPPQQNDLEIPESPTYENFT                                                 631 - 655
//

Text Mined References (32)

PMID Year Title
26303094 2016 CD229 Expression on Bone Marrow Plasma Cells from Patients with Multiple Myeloma and Monoclonal Gammopathies of Uncertain Significance.
26221972 2015 A polymorphism in a phosphotyrosine signalling motif of CD229 (Ly9, SLAMF3) alters SH2 domain binding and T-cell activation.
26001047 2015 CD229 is expressed on the surface of plasma cells carrying an aberrant phenotype and chemotherapy-resistant precursor cells in multiple myeloma.
24927415 2014 The expression of the hepatocyte SLAMF3 (CD229) receptor enhances the hepatitis C virus infection.
24376606 2013 Identification of SLAMF3 (CD229) as an inhibitor of hepatocellular carcinoma cell proliferation and tumour progression.
23956418 2013 Systemic lupus erythematosus immune complexes increase the expression of SLAM family members CD319 (CRACC) and CD229 (LY-9) on plasmacytoid dendritic cells and CD319 on CD56(dim) NK cells.
22989874 2012 CD3-T cell receptor co-stimulation through SLAMF3 and SLAMF6 receptors enhances ROR?t recruitment to the IL17A promoter in human T lymphocytes.
22184727 2012 Increased expression of SLAM receptors SLAMF3 and SLAMF6 in systemic lupus erythematosus T lymphocytes promotes Th17 differentiation.
21606160 2011 Surface molecule CD229 as a novel target for the diagnosis and treatment of multiple myeloma.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
More...