Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.49
PubTator Score 11.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.31319860961485E-12
ulcerative colitis 2087 4.83295660602531E-5
colon cancer 1475 0.00483021425886908
nephrosclerosis 329 0.00506704191062295
active Crohn's disease 918 0.0352061109399591
Disease Target Count Z-score Confidence
Distal arthrogryposis 45 3.268 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis -1.247 0.005
colon cancer -2.300 0.005
active Crohn's disease -1.810 0.035
ulcerative colitis -2.000 0.000
psoriasis -1.200 0.000

Synonym

Accession Q9HBB8 C9J7X1 Q9H746 Q9HAU3 Q9HBB5 Q9HBB6 Q9HBB7 Q9NX86 Q9NXI9
Symbols MLPCDH
MUCDHL
MUPCDH
MU-PCDH

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

Pathway (1)

Gene RIF (9)

PMID Text
26463459 It suggests that methylation status of MUPCDH promoter can be used as a novel epigenetic biomarker and a therapeutic target in ADPKD.
24725409 Study found that brush border assembly is driven by the formation of Ca(2+)-dependent adhesion links between adjacent microvilli. Intermicrovillar links are composed of protocadherin-24 and mucin-like protocadherin, which target to microvillar tips and interact to form a trans-heterophilic complex.
22202456 The transcription factor Cdx2 activates expression of the protocadherin Mucdhl, which interacts with beta-catenin and regulates activities of colon cancer cells.
21839066 The MUPCDH genetic polymorphism rs3758650 was considered a genetic marker to predict symptomatic Gallstone disease subjects.
21315419 Our data consequently suggest that down-regulation of mu-protocadherin expression is a common event in colorectal carcinogenesis and might therefore play an important role in this pathologic process.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12589428 MUCDHL genes are biallelically expressed in multiple fetal and adult tissues both in humans and in mice
12167596 identifed the human mu-protocadherin ortholog and examined its expression in the developing kidney

AA Sequence

MGSWALLWPPLLFTGLLVRPPGTMAQAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFA      1 - 70
FRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVEEDTKVN     71 - 140
STVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSVNRPALRLDRPLDFYERPNMTFWLLVRDTPG    141 - 210
ENVEPSHTATATLVLNVVPADLRPPWFLPCTFSDGYVCIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGD    211 - 280
RGINQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGS    281 - 350
PPRFPQRLYRGTVARGAGAGVVVKDAAAPSQPLRIQAQDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT    351 - 420
TLAQAGAFYAEVEAHNTVTSGTATTVIEIQVSEQEPPSTDVPPSPEAGGTTGPWTSTTSEVPRPPEPSQG    421 - 490
PSTTSSGGGTGPHPPSGTTLRPPTSSTPGGPPGAENSTSHQPATPGGDTAQTPKPGTSQPMPPGVGTSTS    491 - 560
HQPATPSGGTAQTPEPGTSQPMPPSMGTSTSHQPATPGGGTAQTPEAGTSQPMPPGMGTSTSHQPTTPGG    561 - 630
GTAQTPEPGTSQPMPLSKSTPSSGGGPSEDKRFSVVDMAALGGVLGALLLLALLGLAVLVHKHYGPRLKC    631 - 700
CCGKAPEPQPQGFDNQAFLPDHKANWAPVPSPTHDPKPAEAPMPAEPAPPGPASPGGAPEPPAAARAGGS    701 - 770
PTAVRSILTKERRPEGGYKAVWFGEDIGTEADVVVLNAPTLDVDGASDSGSGDEGEGAGRGGGPYDAPGG    771 - 840
DDSYI                                                                     841 - 845
//

Text Mined References (23)

PMID Year Title
26812018 2016 ANKS4B Is Essential for Intermicrovillar Adhesion Complex Formation.
26463459 2015 Epigenetic silencing of the MUPCDH gene as a possible prognostic biomarker for cyst growth in ADPKD.
24725409 2014 Intestinal brush border assembly driven by protocadherin-based intermicrovillar adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22202456 2012 Cdx2 controls expression of the protocadherin Mucdhl, an inhibitor of growth and ?-catenin activity in colon cancer cells.
21839066 2011 Polymorphism at the mucin-like protocadherin gene influences susceptibility to gallstone disease.
21315419 2011 Down-regulation of ?-protocadherin expression is a common event in colorectal carcinogenesis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...