Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.90
PubTator Score 11.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.3e-12
ulcerative colitis 1819 2.8e-04
colon cancer 1478 4.8e-03
active Crohn's disease 922 2.8e-02
nephrosclerosis 333 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Distal arthrogryposis 42 3.12 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -1.395 2.8e-02
colon cancer -2.300 4.8e-03
nephrosclerosis -1.124 4.0e-02
psoriasis -1.200 1.3e-12
ulcerative colitis -1.400 2.8e-04

Gene RIF (10)

AA Sequence

MGSWALLWPPLLFTGLLVRPPGTMAQAQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFA      1 - 70
FRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFPFKTKEIRVEEDTKVN     71 - 140
STVIPETQLQAEDRDKDDILFYTLQEMTAGASDYFSLVSVNRPALRLDRPLDFYERPNMTFWLLVRDTPG    141 - 210
ENVEPSHTATATLVLNVVPADLRPPWFLPCTFSDGYVCIQAQYHGAVPTGHILPSPLVLRPGPIYAEDGD    211 - 280
RGINQPIIYSIFRGNVNGTFIIHPDSGNLTVARSVPSPMTFLLLVKGQQADLARYSVTQVTVEAVAAAGS    281 - 350
PPRFPQRLYRGTVARGAGAGVVVKDAAAPSQPLRIQAQDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT    351 - 420
TLAQAGAFYAEVEAHNTVTSGTATTVIEIQVSEQEPPSTDVPPSPEAGGTTGPWTSTTSEVPRPPEPSQG    421 - 490
PSTTSSGGGTGPHPPSGTTLRPPTSSTPGGPPGAENSTSHQPATPGGDTAQTPKPGTSQPMPPGVGTSTS    491 - 560
HQPATPSGGTAQTPEPGTSQPMPPSMGTSTSHQPATPGGGTAQTPEAGTSQPMPPGMGTSTSHQPTTPGG    561 - 630
GTAQTPEPGTSQPMPLSKSTPSSGGGPSEDKRFSVVDMAALGGVLGALLLLALLGLAVLVHKHYGPRLKC    631 - 700
CCGKAPEPQPQGFDNQAFLPDHKANWAPVPSPTHDPKPAEAPMPAEPAPPGPASPGGAPEPPAAARAGGS    701 - 770
PTAVRSILTKERRPEGGYKAVWFGEDIGTEADVVVLNAPTLDVDGASDSGSGDEGEGAGRGGGPYDAPGG    771 - 840
DDSYI                                                                     841 - 845
//

Text Mined References (24)

PMID Year Title