Property Summary

NCBI Gene PubMed Count 38
Grant Count 73
R01 Count 44
Funding $6,893,854.78
PubMed Score 35.50
PubTator Score 96.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 0.001
juvenile dermatomyositis 1.445 0.000
tuberculosis 1.100 0.000
lung cancer -1.900 0.000
interstitial cystitis 1.700 0.002
pilocytic astrocytoma 1.100 0.000
subependymal giant cell astrocytoma 1.400 0.011
ulcerative colitis 1.100 0.000
ovarian cancer -1.800 0.000
pituitary cancer -1.500 0.000

Synonym

Accession Q9HB58 B4DVI4 F5H1M1 Q14976 Q14977 Q53TG2 Q8WUZ6 Q9HCT8
Symbols IPR1
VODI
IFI41
IFI75

Gene

Gene RIF (31)

PMID Text
25980612 Infectious wild type HIV-1 production is enhanced by 293T cells over-expressing SP110
25006821 Results show that SP110 variants were associated with increased susceptibility to both pulmonary and extra-pulmonary tuberculosis in the Vietnamese patients. Those variants may influence macrophage signaling responses and apoptosis during the infection.
23129390 Study suggests that a combination of SP110 and MYBBP1A gene polymorphisms may serve as a novel marker for identifying the risk of developing TB in the Chinese Han population.
22691368 In a pooled analysis of 10,624 cases of tuberculosis, there was not a significant association between polymorphisms in the SP110 gene and disease susceptibility. [Meta-analysis]
22621957 a range of mutations in SP110 that cause decreased SP110 protein levels and impaired late B-cell differentiation cause veno-occlusive disease with immunodeficiency syndrome.
22522001 Genotyped 20 SNPs located in the SP110 gene, for the first time in a South East Asian cohort from Indonesia.Our study did not reveal any statistically significant associations between SP110 SNPs and pulmonary TB.
21536091 the results might indicate a role of SP110 variants in extrapulmonary tuberculosis rather than PTB.
21397050 This study demonstrates that genotypes and haplotypes of SP110 might be associated with susceptibility to tuberculosis in Chinese population.
21222611 identification of two proteins: the human remodeling and spacing factor 1 (RSF1) and the activating transcription factor 7 interacting protein (ATF7IP) that interact with human SP110 during the process of viral infections
21033425 Several SNPs in Sp110 are risk factors for susceptibility to tuberculosis in Chongqing Han People.
More...

AA Sequence

MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILT      1 - 70
QLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYEWQSRDTPILLEAPTGLAEGSSLHTPLALP     71 - 140
PPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDS    141 - 210
EEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKR    211 - 280
KRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEE    281 - 350
IIDGTSEMNEGKRSQKTPSTPRRVTQGAASPGHGIQEKLQVVDKVTQRKDDSTWNSEVMMRVQKARTKCA    351 - 420
RKSRLKEKKKEKDICSSSKRRFQKNIHRRGKPKSDTVDFHCSKLPVTCGEAKGILYKKKMKHGSSVKCIR    421 - 490
NEDGTWLTPNEFEVEGKGRNAKNWKRNIRCEGMTLGELLKRKNSDECEVCCQGGQLLCCGTCPRVFHEDC    491 - 560
HIPPVEAKRMLWSCTFCRMKRSSGSQQCHHVSKTLERQMQPQDQLIRDYGEPFQEAMWLDLVKERLITEM    561 - 630
YTVAWFVRDMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTLP               631 - 689
//

Text Mined References (45)

PMID Year Title
25006821 2014 Polymorphisms of SP110 are associated with both pulmonary and extra-pulmonary tuberculosis among the Vietnamese.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129390 2013 Identification of genetic associations of SP110/MYBBP1A/RELA with pulmonary tuberculosis in the Chinese Han population.
22700719 2012 Common variation at 6p21.31 (BAK1) influences the risk of chronic lymphocytic leukemia.
22691368 2012 SP110 gene polymorphisms and tuberculosis susceptibility: a systematic review and meta-analysis based on 10 624 subjects.
22621957 2012 Clinical, molecular, and cellular immunologic findings in patients with SP110-associated veno-occlusive disease with immunodeficiency syndrome.
More...