Property Summary

NCBI Gene PubMed Count 41
PubMed Score 39.29
PubTator Score 96.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
tuberculosis 1.100 2.9e-04
Astrocytoma, Pilocytic 1.100 8.1e-07
cutaneous lupus erythematosus 1.600 1.0e-03
interstitial cystitis 1.400 1.9e-03
juvenile dermatomyositis 1.445 8.0e-17
lung cancer -1.900 3.7e-04
ovarian cancer -1.800 4.1e-07
pituitary cancer -1.100 4.8e-06
subependymal giant cell astrocytoma 1.400 1.1e-02
ulcerative colitis 1.100 5.5e-06

Gene RIF (34)

AA Sequence

MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILT      1 - 70
QLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYEWQSRDTPILLEAPTGLAEGSSLHTPLALP     71 - 140
PPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDS    141 - 210
EEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKR    211 - 280
KRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEE    281 - 350
IIDGTSEMNEGKRSQKTPSTPRRVTQGAASPGHGIQEKLQVVDKVTQRKDDSTWNSEVMMRVQKARTKCA    351 - 420
RKSRLKEKKKEKDICSSSKRRFQKNIHRRGKPKSDTVDFHCSKLPVTCGEAKGILYKKKMKHGSSVKCIR    421 - 490
NEDGTWLTPNEFEVEGKGRNAKNWKRNIRCEGMTLGELLKRKNSDECEVCCQGGQLLCCGTCPRVFHEDC    491 - 560
HIPPVEAKRMLWSCTFCRMKRSSGSQQCHHVSKTLERQMQPQDQLIRDYGEPFQEAMWLDLVKERLITEM    561 - 630
YTVAWFVRDMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTLP               631 - 689
//

Text Mined References (48)

PMID Year Title