Property Summary

NCBI Gene PubMed Count 8
PubMed Score 280.18
PubTator Score 8.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 4.6e-05
lung cancer 4740 3.7e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.600 3.7e-03
ovarian cancer 1.500 4.6e-05

Synonym

Accession Q9HB07
Symbols MYG
MYG1
Gamm1
MST024
MSTP024

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MGHQFLRGLLTLLLPPPPLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEALACALLRLLPE      1 - 70
YRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLSPGKPWQTKLSSAGLIYLHFG     71 - 140
HKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGISQWAEGEPRYALTTTLSARVARLNPTWNHPD    141 - 210
QDTEAGFKRAMDLVQEEFLQRLDFYQHSWLPARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLE    211 - 280
SGLSPPVAIFFVIYTDQAGQWRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFTG    281 - 350
GHHTREGALSMARATLAQRSYLPQIS                                                351 - 376
//

Text Mined References (12)

PMID Year Title