Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 6
Funding $260,505.37
PubMed Score 13.20
PubTator Score 12.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
breast carcinoma -1.800 0.006
invasive ductal carcinoma -1.672 0.017
psoriasis -1.300 0.000
non-inflammatory breast cancer -4.500 0.000

Gene RIF (8)

PMID Text
25704993 Ropporin gene expression is related to the sperm motility. Its abnormal expression in the sperm of asthenozoospermic men with varicocele is associated with impaired sperm motility that is improved after varicocelectomy.
22021175 Lack of ROPN1 had no effect on ciliary motility.
21654522 We suggest that ropporin is a promising target for MM immunotherapy, as we were able to generate human leukocyte antigen class I-restricted cytotoxic lymphocytes able to kill autologous MM cells.
21240291 CABYR variants form a complex not only with the scaffolding protein AKAP3 but also with another RII-like domain-containing protein in the sperm fibrous sheath.
20705794 ropporin was predominantly expressed in round spermatids in human testis, and located in the principal piece and end piece of spermatozoa flagella. Expression level of ropporin was significantly lower in asthenozoospermic men than in normozoospermic men.
20107840 One SNP (rs4499545) in the ROPN1-KALRN intergenic region showed significant allelic and genotypic association with ischemic stroke risk.
20107840 Observational study of gene-disease association. (HuGE Navigator)
17551920 Ropporin gene expression in tumor cells is associated with the presence of high titer IgG antibodies against Ropporin, suggesting the in vivo translation of the mRNA into protein and the immunogenicity of the protein to the autologous hosts.

AA Sequence

MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPE      1 - 70
LLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKI     71 - 140
VCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQ    141 - 210
LE                                                                        211 - 212
//

Text Mined References (16)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25704993 2015 Ropporin gene expression in infertile asthenozoospermic men with varicocele before and after repair.
25416956 2014 A proteome-scale map of the human interactome network.
22021175 2012 Loss of ASP but not ROPN1 reduces mammalian ciliary motility.
21654522 Cancer testis antigen, ropporin, is a potential target for multiple myeloma immunotherapy.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21240291 2011 CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath.
20705794 Functional expression of ropporin in human testis and ejaculated spermatozoa.
20107840 2010 Kalirin: a novel genetic risk factor for ischemic stroke.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
More...