Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.82
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 7.9e-19
psoriasis 6694 3.0e-07
breast carcinoma 1638 5.7e-03
invasive ductal carcinoma 2951 1.7e-02
Disease Target Count Z-score Confidence
Opisthorchiasis 15 3.367 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -4.000 7.9e-19
breast carcinoma -1.800 5.7e-03
invasive ductal carcinoma -1.621 1.7e-02
psoriasis -1.100 3.0e-07

Synonym

Accession Q9HAT0 D3DN99 Q9UF38
Symbols CT91
ODF6
ROPN1A
RHPNAP1
ropporin

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPE      1 - 70
LLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKI     71 - 140
VCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQ    141 - 210
LE                                                                        211 - 212
//

Text Mined References (16)

PMID Year Title