Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.51
PubTator Score 103.87

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.269 3.4e-02
astrocytoma 1.200 1.8e-02
atypical teratoid / rhabdoid tumor 1.400 1.1e-04
ependymoma 1.600 1.2e-02
glioblastoma 1.500 6.1e-05
medulloblastoma, large-cell 1.900 7.1e-05
oligodendroglioma 1.400 3.3e-03
osteosarcoma -1.597 1.2e-05
ovarian cancer -2.400 4.8e-11
psoriasis -1.400 6.5e-08
sonic hedgehog group medulloblastoma 1.100 2.8e-04
Waldenstrons macroglobulinemia -1.023 4.1e-02

Gene RIF (14)

AA Sequence

MAADVFMCSPRRPRSRGRQVLLKPQVSEDDDDSDTDEPSPPPASGAATPARAHASAAPPPPRAGPGREEP      1 - 70
PRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQTYSFGKTSSCHLSIDASLTKLFECMTLAYSGK     71 - 140
LVSPKWKNFKGLKLQWRDKIRLNNAIWRAWYMQYLEKRKNPVCHFVTPLDGSVDVDEHRRPEAITTEGKY    141 - 210
WKSRIEIVIREYHKWRTYFKKRLQQHKDEDLSSLVQDDDMLYWHKHGDGWKTPVPMEEDPLLDTDMLMSE    211 - 280
FSDTLFSTLSSHQPVAWPNPREIAHLGNADMIQPGLIPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPAS    281 - 350
ASAPVPDPNNPPAQESILPTTALPTVSLPDSLIAPPTAPSLAHMDEQGCEHTSRTEDPFIQPTDFGPSEP    351 - 420
PLSVPQPFLPVFTMPLLSPSPAPPPISPVLPLVPPPATALNPPAPPTFHQPQKFAGVNKAPSVITHTASA    421 - 490
TLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVHPKPVSLTGGRPKQPHKIVPA    491 - 560
PKPEPVSLVLKNARIAPAAFSGQPQAVIMTSGPLKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSSIL    561 - 630
VTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQS    631 - 700
PQNNCSGKSDPKNVAALKNRQMKHISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVEYITKLQ    701 - 770
QERGQMQEEARRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYVKTRTLQNWKFWIFSII    771 - 840
IKPLFESFKGMVSTSSLEELHRTALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQLPEQASKAVT    841 - 910
RIGKRLGES                                                                 911 - 919
//

Text Mined References (27)

PMID Year Title