Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.04
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.500 0.000
hepatocellular carcinoma 1.300 0.000
osteosarcoma -1.155 0.004
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.200 0.004
medulloblastoma, large-cell -1.400 0.007
non-small cell lung cancer -1.058 0.000
subependymal giant cell astrocytoma -1.279 0.017
invasive ductal carcinoma -1.600 0.001
ovarian cancer -2.300 0.000

Gene RIF (4)

PMID Text
20588308 Observational study of gene-disease association. (HuGE Navigator)
19015240 findings demonstrate new functions for SAP30L and SAP30 by showing that they can associate directly with core histones as well as naked DNA
18070604 transcriptional repression mediated by SAP30L can be influenced by alternative mRNA splicing
14680513 SAP30L, a nuclear protein, is upregulated by transforming growth factor-beta in intestinal epithelial cells

AA Sequence

MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRH      1 - 70
LYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLA     71 - 140
ETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE                               141 - 183
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19015240 2009 DNA-binding and -bending activities of SAP30L and SAP30 are mediated by a zinc-dependent module and monophosphoinositides.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18070604 2008 Alternative mRNA splicing of SAP30L regulates its transcriptional repression activity.
More...