Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.33
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 4.5e-04
gastric cancer 1.500 3.1e-04
glioblastoma -1.200 4.3e-03
hepatocellular carcinoma 1.300 7.3e-07
invasive ductal carcinoma -1.600 6.8e-04
medulloblastoma, large-cell -1.400 7.3e-03
non-small cell lung cancer -1.058 2.2e-13
osteosarcoma -1.062 5.6e-04
ovarian cancer -2.300 1.7e-06
subependymal giant cell astrocytoma -1.279 1.7e-02

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRH      1 - 70
LYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLA     71 - 140
ETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE                               141 - 183
//

Text Mined References (20)

PMID Year Title