Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.20
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
adrenocortical carcinoma 1.238 6.7e-06
osteosarcoma -1.272 2.2e-02
ovarian cancer -1.400 1.1e-05
Pick disease -1.100 1.5e-04

Gene RIF (5)

AA Sequence

MLRWLIGGGREPQGLAEKSPLQTIGEEQTQNPYTELLVLKAHHDIVRFLVQLDDYRFASAGDDGIVVVWN      1 - 70
AQTGEKLLELNGHTQKITAIITFPSLESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLT     71 - 140
VLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPKNCVVAAVGKELIIFRLVAPTEGSLEW    141 - 210
DILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDALDWTMQAYERNFWDPSPQLDTQQEIKLCQK    211 - 280
SNDISIHHFTCDEENVFAAVGRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWE    281 - 350
LREKQQLAAEPVPTGFFNMWGFGRVSKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLV    351 - 420
TCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYLAV                                   421 - 459
//

Text Mined References (16)

PMID Year Title