Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $77,063.75
PubMed Score 29.89
PubTator Score 14.52

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9HA82 D6W665 CerS4
Symbols Trh1
LASS4

Gene

 Grant Application (2)

Gene RIF (5)

PMID Text
26887952 These results suggest that the phosphorylation of ceramide synthases may be a key regulatory point in the control of the distribution and levels of sphingolipids of various acyl-chain lengths.
25779024 mRNA level of CerS4 is higher in cancerous cell lines and decreases following the induction of apoptosis.
23538298 Co-expression of CerS2 with CerS4/CerS6 reversed the inhibitory effect of long chain ceramides on cell proliferation and the induction of apoptosis. we detected no effect on cell proliferation.
21757428 The linkage and association of phospholipid transfer protein activity to LASS4 were studied.
20080650 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGV      1 - 70
RDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRF     71 - 140
LFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQV    141 - 210
IHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLF    211 - 280
PTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSS    281 - 350
EEAAAAQEPLQLKNGAAGGPRPAPTDGPRSRVAGRLTNRHTTAT                              351 - 394
//

Text Mined References (13)

PMID Year Title
26887952 2016 Enzyme Activities of the Ceramide Synthases CERS2-6 Are Regulated by Phosphorylation in the C-terminal Region.
25779024 2015 Linking the ceramide synthases (CerSs) 4 and 5 with apoptosis, endometrial and colon cancers.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23538298 2013 The equilibrium between long and very long chain ceramides is important for the fate of the cell and can be influenced by co-expression of CerS.
21757428 2011 Linkage and association of phospholipid transfer protein activity to LASS4.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
More...