Property Summary

NCBI Gene PubMed Count 10
PubMed Score 44.05
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 27 1 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 3.3e-09
malignant mesothelioma 3232 5.8e-06
osteosarcoma 7950 1.3e-05
psoriasis 6694 2.3e-04
ovarian cancer 8520 3.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.100 5.8e-06
osteosarcoma -1.427 1.3e-05
ovarian cancer -1.100 3.8e-04
psoriasis 1.100 2.3e-04
tuberculosis 1.700 3.3e-09

Gene RIF (4)

AA Sequence

MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTGRKEPLIVAHA      1 - 70
EAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITDVDDKIIKRANEMNISPASLA     71 - 140
SLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIARGNAYSTAKGNVYFDLKSRGDKYGKLVGV    141 - 210
VPGPVGEPADSDKRHASDFALWKAAKPQEVFWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAF    211 - 280
PHHENEIAQCEVFHQCEQWGNYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYR    281 - 350
SAIDYSDSAMLQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVV    351 - 420
DAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDEL    421 - 490
VRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQRTKDQ    491 - 560
KSAG                                                                      561 - 564
//

Text Mined References (12)

PMID Year Title