Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 4.73644608887409E-10
ovarian cancer 8492 2.57779740777104E-7
psoriasis 6685 7.05063276112821E-5
medulloblastoma, large-cell 6234 5.44652261426016E-4
glioblastoma 5572 7.58330446396711E-4
osteosarcoma 7933 0.00101929442121892
adult high grade glioma 2148 0.00239878036124583

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.210 0.001
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.600 0.001
juvenile dermatomyositis 1.071 0.000
adult high grade glioma -1.100 0.002
ovarian cancer -1.500 0.000

Synonym

Accession Q9H9P5 B0QYN6 B1GXI8 Q96EV1 Q96RZ1 Q9BWL5 Q9H5K0 Q9UJJ8
Symbols ZC3H5L
C16orf28
ZC3HDC5L

Gene

  Ortholog (4)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

Gene RIF (1)

PMID Text
1339381 Characterizes the related Drosophila gene and protein.

AA Sequence

MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRD      1 - 70
GTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAF     71 - 140
AHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKT    141 - 210
EQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYRSTPCPSVKHGDEWGEPSRCDGGDGCQYCHSRTEQQ    211 - 280
FHPESTKCNDMRQTGYCPRGPFCAFAHVEKSLGMVNEWGCHDLHLTSPSSTGSGQPGNAKRRDSPAEGGP    281 - 350
RGSEQDSKQNHLAVFAAVHPPAPSVSSSVASSLASSAGSGSSSPTALPAPPARALPLGPASSTVEAVLGS    351 - 420
ALDLHLSNVNIASLEKDLEEQDGHDLGAAGPRSLAGSAPVAIPGSLPRAPSLHSPSSASTSPLGSLSQPL    421 - 490
PGPVGSSAMTPPQQPPPLRSEPGTLGSAASSYSPLGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSA    491 - 560
SPNGAELARVRRQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQV    561 - 630
IFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYCKGQPLQW                        631 - 680
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20148946 2010 The SWI/SNF protein BAF60b is ubiquitinated through a signalling process involving Rac GTPase and the RING finger protein Unkempt.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...