Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.55
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.600 5.3e-04
astrocytic glioma -1.300 5.0e-02
Astrocytoma, Pilocytic -1.200 2.1e-04
atypical teratoid / rhabdoid tumor -2.000 1.2e-07
ependymoma -1.700 4.0e-02
glioblastoma -1.500 4.1e-06
group 3 medulloblastoma -1.400 3.9e-03
malignant mesothelioma 1.300 2.5e-06
medulloblastoma, large-cell -2.300 2.2e-05
primitive neuroectodermal tumor -1.500 5.1e-04
subependymal giant cell astrocytoma -3.096 1.7e-02

Gene RIF (1)

AA Sequence

MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ      1 - 70
RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW     71 - 140
TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV               141 - 199
//

Text Mined References (5)

PMID Year Title