Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.42
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q9H9H5
Symbols SL21
MAPO6D1

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
16837464 This paper describes the conserved domains, localization and function of the mouse MAP6D1 protein. It also compared the sequences of the related proteins in mouse, human and other species.

AA Sequence

MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ      1 - 70
RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW     71 - 140
TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV               141 - 199
//

Text Mined References (5)

PMID Year Title
25526643 2014 Non-microtubular localizations of microtubule-associated protein 6 (MAP6).
16837464 2006 STOP-like protein 21 is a novel member of the STOP family, revealing a Golgi localization of STOP proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.