Property Summary

NCBI Gene PubMed Count 5
PubMed Score 10.42
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.79156033177254E-16
atypical teratoid/rhabdoid tumor 1095 2.17652845246078E-10
medulloblastoma 1524 1.29699533158257E-9
pediatric high grade glioma 2712 5.45054046122759E-8
malignant mesothelioma 3163 2.51494358687229E-6
glioblastoma 5572 8.05305643761733E-6
medulloblastoma, large-cell 6234 2.15829796210627E-5
pilocytic astrocytoma 3086 2.12568533172161E-4
primitive neuroectodermal tumor 3031 5.14528541000172E-4
subependymal giant cell astrocytoma 2287 0.0171576065270429
astrocytic glioma 2241 0.0498371451877261
Disease Target Count Z-score Confidence
Autonomic neuropathy 21 4.551 2.3

Expression

  Differential Expression (11)

Synonym

Accession Q9H9H5
Symbols SL21
MAPO6D1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
16837464 This paper describes the conserved domains, localization and function of the mouse MAP6D1 protein. It also compared the sequences of the related proteins in mouse, human and other species.

AA Sequence

MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ      1 - 70
RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW     71 - 140
TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV               141 - 199
//

Text Mined References (5)

PMID Year Title
25526643 2014 Non-microtubular localizations of microtubule-associated protein 6 (MAP6).
16837464 2006 STOP-like protein 21 is a novel member of the STOP family, revealing a Golgi localization of STOP proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.