Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.81
PubTator Score 2.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 8.8e-03
Breast cancer 3.900 4.5e-02
dermatomyositis 1.600 4.1e-04
hepatocellular carcinoma 1.100 6.4e-05
ovarian cancer -1.300 1.3e-03
pancreatic ductal adenocarcinoma liver m... -1.102 2.9e-02
primary Sjogren syndrome 1.200 3.1e-04
tuberculosis and treatment for 6 months -1.100 1.5e-03

Gene RIF (4)

AA Sequence

MAVVPASLSGQDVGSFAYLTIKDRIPQILTKVIDTLHRHKSEFFEKHGEEGVEAEKKAISLLSKLRNELQ      1 - 70
TDKPFIPLVEKFVDTDIWNQYLEYQQSLLNESDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVF     71 - 140
KESKEQNFYGSQESIIALCTHLQQLIRTIEDLDENQLKDEFFKLLQISLWGNKCDLSLSGGESSSQNTNV    141 - 210
LNSLEDLKPFILLNDMEHLWSLLSNCKKTREKASATRVYIVLDNSGFELVTDLILADFLLSSELATEVHF    211 - 280
YGKTIPWFVSDTTIHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAP    281 - 350
DLYAELQKAHLILFKGDLNYRKLTGDRKWEFSVPFHQALNGFHPAPLCTIRTLKAEIQVGLQPGQGEQLL    351 - 420
ASEPSWWTTGKYGIFQYDGPL                                                     421 - 441
//

Text Mined References (17)

PMID Year Title