Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.70
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.500 3.2e-04
astrocytoma 1.300 4.7e-16
atypical teratoid/rhabdoid tumor 1.100 2.9e-04
Breast cancer -1.400 4.8e-11
ependymoma 2.000 2.7e-11
glioblastoma 1.500 3.5e-07
group 3 medulloblastoma 1.400 4.8e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.4e-02
invasive ductal carcinoma 1.200 9.1e-03
medulloblastoma, large-cell 1.100 2.7e-05
osteosarcoma -1.733 1.8e-06
ovarian cancer -1.100 6.2e-05
pancreatic cancer 1.100 3.1e-05
pancreatic carcinoma 1.100 3.1e-05
pancreatic ductal adenocarcinoma liver m... -1.164 1.5e-02
psoriasis -1.200 5.2e-04
tuberculosis and treatment for 6 months 1.300 3.2e-04

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRG      1 - 70
VESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRV     71 - 140
SGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNV    141 - 210
VVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVK    211 - 280
EGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY       281 - 347
//

Text Mined References (7)

PMID Year Title