Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.50
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 4.66218998438479E-16
Breast cancer 3099 4.80942899810905E-11
posterior fossa group B ependymoma 1530 1.61450087014876E-9
glioblastoma 5572 3.53169418152551E-7
osteosarcoma 7933 1.81610482069575E-6
medulloblastoma, large-cell 6234 2.73074780551396E-5
pancreatic cancer 2300 3.05551203404275E-5
pancreatic carcinoma 567 3.05551203404275E-5
ovarian cancer 8492 6.19186355963782E-5
atypical teratoid/rhabdoid tumor 1095 2.94817600958643E-4
adult high grade glioma 2148 3.19601070581131E-4
tuberculosis and treatment for 6 months 686 3.21512700254448E-4
group 3 medulloblastoma 2254 4.80519147423271E-4
psoriasis 6685 5.21383210406884E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0016577071031227
invasive ductal carcinoma 2950 0.00908498534789258
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.023782728215476

Expression

Synonym

Accession Q9H903 Q6P079 Q8N560
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTVPVRGFSLLRGRLGRAPALGRSTAPSVRAPGEPGSAFRGFRSSGVRHEAIIISGTEMAKHIQKEIQRG      1 - 70
VESWVSLGNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRV     71 - 140
SGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCLDQHSLIPATASAVWEIIKRTGIQTFGKNV    141 - 210
VVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTPKEQLKIHTQLADIIIVAAGIPKLITSDMVK    211 - 280
EGAAVIDVGINYVHDPVTGKTKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKKIIY       281 - 347
//

Text Mined References (7)

PMID Year Title
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21163947 2011 Mammalian MTHFD2L encodes a mitochondrial methylenetetrahydrofolate dehydrogenase isozyme expressed in adult tissues.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.