Property Summary

NCBI Gene PubMed Count 31
PubMed Score 28.17
PubTator Score 35.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (23)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.022 4.0e-05
astrocytoma -1.400 1.3e-13
atypical teratoid / rhabdoid tumor -2.800 8.8e-04
colon cancer -1.700 4.8e-02
ductal carcinoma in situ 1.400 1.4e-02
glioblastoma -1.500 3.7e-03
interstitial cystitis 1.300 3.4e-02
intraductal papillary-mucinous adenoma (... -1.700 1.8e-02
intraductal papillary-mucinous carcinoma... -1.900 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.400 1.1e-02
lung adenocarcinoma -1.100 2.7e-20
lung cancer -1.900 1.3e-03
medulloblastoma, large-cell -1.200 3.8e-02
non-small cell lung cancer -1.752 8.6e-14
oligodendroglioma -1.100 1.0e-07
osteosarcoma 2.666 4.1e-03
ovarian cancer -6.200 2.3e-22
pancreatic cancer -1.600 1.1e-04
pediatric high grade glioma -1.900 3.6e-03
Pick disease -1.500 1.5e-02
primary pancreatic ductal adenocarcinoma -1.538 2.1e-04
psoriasis 2.500 4.7e-04
sonic hedgehog group medulloblastoma -1.700 1.2e-02

Gene RIF (22)

AA Sequence

MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKI      1 - 70
AFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKG     71 - 140
QGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA             141 - 201
//

Text Mined References (33)

PMID Year Title