Property Summary

NCBI Gene PubMed Count 10
PubMed Score 22.92
PubTator Score 2.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 4.2e-04
atypical teratoid / rhabdoid tumor 1.500 1.8e-07
glioblastoma 1.100 3.4e-07
group 3 medulloblastoma 1.100 1.7e-03
osteosarcoma -1.494 7.0e-05
primitive neuroectodermal tumor 1.100 3.4e-03

Gene RIF (3)

AA Sequence

MSENRKPLLGFVSKLTSGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSD      1 - 70
TSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLESLRGEGQGLVCDLCND     71 - 140
REVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLKGYSRIGKPILCPVHPAEELRLFCEFCDRPV    141 - 210
CQDCVVGEHREHPCDFTSNVIHKHGDSVWELLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVRTF    211 - 280
SEGYIKAIEEHRDKLLKQLEDIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVV    281 - 350
VERLRKLNKVQYSTRPGVNDKIRFCPQEKAGQCRGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQTASF    351 - 420
TLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVYTVWVCIKEQHVQG    421 - 490
SPFTVMVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHGHKGHPGHPHWSCCGKFNEKS    491 - 560
ECTWTGGQSAPRSLLRTVAL                                                      561 - 580
//

Text Mined References (10)

PMID Year Title