Property Summary

NCBI Gene PubMed Count 10
Grant Count 3
R01 Count 3
Funding $149,808.58
PubMed Score 21.62
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.494 0.000
glioblastoma 1.100 0.000
group 4 medulloblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
primitive neuroectodermal tumor 1.100 0.003
adult high grade glioma 1.100 0.000

Synonym

Accession Q9H8W5 Q53GN0 Q5T2K4 Q5T2K5 Q8IYV6
Symbols RNF99

Gene

PANTHER Protein Class (2)

PDB

2DS4  

Gene RIF (3)

PMID Text
24681954 The TRIM-FLMN protein TRIM45 directly interacts with RACK1 and negatively regulates PKC-mediated signaling pathway.
22634006 These findings suggest that TRIM45 acts as a repressor for the NF-kappaB signal and regulates cell growth.
15351693 TRIM45 may act as a new transcriptional repressor in mitogen-activated protein kinase signaling pathway

AA Sequence

MSENRKPLLGFVSKLTSGTALGNSGKTHCPLCLGLFKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSD      1 - 70
TSSEGSIFQELKPRSLQSQIGILCPVCDAQVDLPMGGVKALTIDHLAVNDVMLESLRGEGQGLVCDLCND     71 - 140
REVEKRCQTCKANLCHFCCQAHRRQKKTTYHTMVDLKDLKGYSRIGKPILCPVHPAEELRLFCEFCDRPV    141 - 210
CQDCVVGEHREHPCDFTSNVIHKHGDSVWELLKGTQPHVEALEEALAQIHIINSALQKRVEAVAADVRTF    211 - 280
SEGYIKAIEEHRDKLLKQLEDIRAQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILITKRVV    281 - 350
VERLRKLNKVQYSTRPGVNDKIRFCPQEKAGQCRGYEIYGTINTKEVDPAKCVLQGEDLHRAREKQTASF    351 - 420
TLLCKDAAGEIMGRGGDNVQVAVVPKDKKDSPVRTMVQDNKDGTYYISYTPKEPGVYTVWVCIKEQHVQG    421 - 490
SPFTVMVRRKHRPHSGVFHCCTFCSSGGQKTARCACGGTMPGGYLGCGHGHKGHPGHPHWSCCGKFNEKS    491 - 560
ECTWTGGQSAPRSLLRTVAL                                                      561 - 580
//

Text Mined References (10)

PMID Year Title
24681954 2015 The TRIM-FLMN protein TRIM45 directly interacts with RACK1 and negatively regulates PKC-mediated signaling pathway.
22634006 2012 TRIM45 negatively regulates NF-?B-mediated transcription and suppresses cell proliferation.
18673550 2008 Genomic analysis of the TRIM family reveals two groups of genes with distinct evolutionary properties.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351693 2004 TRIM45, a novel human RBCC/TRIM protein, inhibits transcriptional activities of ElK-1 and AP-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.