Property Summary

NCBI Gene PubMed Count 3
PubMed Score 11.57
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.7e-09
ovarian cancer 8520 4.8e-08
psoriasis 6694 4.6e-05

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 2.704 5.7e-09
ovarian cancer 1.400 4.8e-08
psoriasis 2.300 4.6e-05

AA Sequence

MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALS      1 - 70
ALGLQGEREYAGDIFAEVMVCRVLPLRALPRAVTPEMRALVVDWLVQVHEYLGLAGDTLYLAVHLLDSYL     71 - 140
SAGRVRLHRLQLLGVACLFVACKMEECVLPEPAFLCLLSADSFSRAELLRAERRILSRLDFRLHHPGPLL    141 - 210
CLGLLAALAGSSPQVMLLATYFLELSLLEAEAAGWEPGRRAAAALSLAHRLLDGAGSRLQPELYRCSLGG    211 - 280
GSVWGHRSFRDLPSWSFLRSRRMRDNY                                               281 - 307
//

Text Mined References (4)

PMID Year Title