Property Summary

NCBI Gene PubMed Count 3
PubMed Score 8.96
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.300 0.000
osteosarcoma 2.704 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q9H8S5 B4DX65
Symbols CCNP

Gene

 Compartment GO Term (1)

AA Sequence

MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALS      1 - 70
ALGLQGEREYAGDIFAEVMVCRVLPLRALPRAVTPEMRALVVDWLVQVHEYLGLAGDTLYLAVHLLDSYL     71 - 140
SAGRVRLHRLQLLGVACLFVACKMEECVLPEPAFLCLLSADSFSRAELLRAERRILSRLDFRLHHPGPLL    141 - 210
CLGLLAALAGSSPQVMLLATYFLELSLLEAEAAGWEPGRRAAAALSLAHRLLDGAGSRLQPELYRCSLGG    211 - 280
GSVWGHRSFRDLPSWSFLRSRRMRDNY                                               281 - 307
//

Text Mined References (4)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11237006 2001 Can sequencing shed light on cell cycling?
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.