Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.76
PubTator Score 38.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.521 5.0e-03
astrocytoma 1.400 4.7e-03
Breast cancer -1.100 5.2e-07
breast carcinoma -1.100 1.7e-26
cutaneous lupus erythematosus -1.300 1.4e-03
cystic fibrosis 1.953 5.5e-05
dermatomyositis 1.600 3.8e-04
glioblastoma multiforme 1.100 2.0e-11
hepatocellular carcinoma -1.100 9.0e-04
interstitial cystitis -1.200 1.5e-05
interstitial lung disease 1.100 5.8e-03
invasive ductal carcinoma -1.500 2.7e-03
malignant mesothelioma -1.600 9.5e-07
Multiple myeloma 1.216 1.7e-02
osteosarcoma -1.652 1.3e-04
ovarian cancer -3.000 7.0e-10
pancreatic cancer -1.300 8.1e-04
Pick disease 1.500 6.5e-04
posterior fossa group A ependymoma 1.100 7.9e-06
primary pancreatic ductal adenocarcinoma -1.171 6.2e-03
psoriasis -1.600 4.8e-11

Gene RIF (10)

AA Sequence

MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGL      1 - 70
QQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPG     71 - 140
AQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDIS    141 - 210
DSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMY    211 - 280
KCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPT    281 - 350
SEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPV    351 - 420
SPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVY    421 - 490
GIEHRDQWCTACRWKKACQRFLD                                                   491 - 513
//

Text Mined References (18)

PMID Year Title