Property Summary

NCBI Gene PubMed Count 13
Grant Count 10
R01 Count 10
Funding $857,536.5
PubMed Score 15.17
PubTator Score 38.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.001
interstitial lung disease 1.100 0.006
Multiple myeloma 1.216 0.017
malignant mesothelioma -1.600 0.000
cutaneous lupus erythematosus -1.300 0.001
glioblastoma multiforme 1.100 0.000
osteosarcoma 2.237 0.000
cystic fibrosis 1.953 0.000
astrocytoma 1.400 0.005
adrenocortical carcinoma 1.521 0.005
primary pancreatic ductal adenocarcinoma -1.171 0.006
interstitial cystitis -1.200 0.000
posterior fossa group A ependymoma 1.100 0.000
psoriasis -1.600 0.000
inflammatory breast cancer -1.100 0.015
breast carcinoma -1.100 0.000
Pick disease 1.500 0.001
invasive ductal carcinoma -1.500 0.003
ovarian cancer -3.000 0.000
pancreatic cancer -1.300 0.001
dermatomyositis 1.600 0.000

Gene RIF (9)

PMID Text
24599008 miR-525-3p promotes liver cancer cell migration and invasion by directly targeting ZNF395.
24086395 IkBalpha kinase (IKK)-signaling is necessary to allow ZNF395 to activate transcription and simultaneously enhances its proteolytic degradation.
23760207 Studies indicate that ZNF395 was strongly expressed in adipocytes, and suggest a role for ZNF395 as a modulator of adipogenesis.
23142027 ZNF395 coordinate the transcriptional regulatory pathway with PPARG2, which may be necessary for the genesis of adipocytes.
19018758 colocalization of PBF and Scythe/BAT3 in the nucleus might be an important factor for survival of osteosarcoma cells.
17897615 PBF binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex
17531190 PBF is a new cellular factor mediating the effects of PI3K/Akt signaling and 14-3-3 on cell growth
15289353 PBF is an osteosarcoma-associated antigen recognized by autologous cytotoxic T-lymphocyte clone in the context of HLA-B*5502.
14625278 HDBP1 and HDBP2 are novel transcription factors shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells

AA Sequence

MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGL      1 - 70
QQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPG     71 - 140
AQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDIS    141 - 210
DSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMY    211 - 280
KCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPT    281 - 350
SEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPV    351 - 420
SPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVY    421 - 490
GIEHRDQWCTACRWKKACQRFLD                                                   491 - 513
//

Text Mined References (17)

PMID Year Title
24599008 2014 MiR-525-3p enhances the migration and invasion of liver cancer cells by downregulating ZNF395.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086395 2013 The hypoxia-inducible transcription factor ZNF395 is controlled by I?B kinase-signaling and activates genes involved in the innate immune response and cancer.
23760207 2013 Emerging roles of zinc finger proteins in regulating adipogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142027 2013 Identification of ZNF395 as a novel modulator of adipogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19018758 2009 Scythe/BAT3 regulates apoptotic cell death induced by papillomavirus binding factor in human osteosarcoma.
17897615 2007 Papillomavirus binding factor binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex.
More...