Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.17
PubTator Score 38.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 1.65022552282447E-26
glioblastoma multiforme 347 2.03480695991503E-11
psoriasis 6685 4.8331748010084E-11
ovarian cancer 8492 6.98305758137553E-10
malignant mesothelioma 3163 9.54304218463273E-7
posterior fossa group A ependymoma 1511 7.8596867811889E-6
osteosarcoma 7933 9.22903012813342E-6
interstitial cystitis 2299 1.50448802480637E-5
cystic fibrosis 1670 5.49452069370593E-5
dermatomyositis 967 3.81398180679716E-4
Pick disease 1893 6.53963050760016E-4
pancreatic cancer 2300 8.06209571696185E-4
hepatocellular carcinoma 550 9.00464982821347E-4
cutaneous lupus erythematosus 1056 0.00144582168099937
invasive ductal carcinoma 2950 0.00268849516458802
astrocytoma 1493 0.00471058096863293
adrenocortical carcinoma 1427 0.00496759789802797
interstitial lung disease 292 0.00580654819001307
primary pancreatic ductal adenocarcinoma 1271 0.00619537335546388
inflammatory breast cancer 404 0.0150024526799742
Multiple myeloma 1328 0.0169024093725657

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.001
interstitial lung disease 1.100 0.006
Multiple myeloma 1.216 0.017
malignant mesothelioma -1.600 0.000
cutaneous lupus erythematosus -1.300 0.001
glioblastoma multiforme 1.100 0.000
osteosarcoma 2.237 0.000
cystic fibrosis 1.953 0.000
astrocytoma 1.400 0.005
adrenocortical carcinoma 1.521 0.005
primary pancreatic ductal adenocarcinoma -1.171 0.006
interstitial cystitis -1.200 0.000
posterior fossa group A ependymoma 1.100 0.000
psoriasis -1.600 0.000
inflammatory breast cancer -1.100 0.015
breast carcinoma -1.100 0.000
Pick disease 1.500 0.001
invasive ductal carcinoma -1.500 0.003
ovarian cancer -3.000 0.000
pancreatic cancer -1.300 0.001
dermatomyositis 1.600 0.000

Synonym

Accession Q9H8N7 B3KUY7 D3DST4 Q6F6H2 Q9BY72 Q9NPB2 Q9NS57 Q9NS58 Q9NS59
Symbols PBF
PRF1
HDBP2
PRF-1
HDBP-2
HDRF-2
Si-1-8-14

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (9)

PMID Text
24599008 miR-525-3p promotes liver cancer cell migration and invasion by directly targeting ZNF395.
24086395 IkBalpha kinase (IKK)-signaling is necessary to allow ZNF395 to activate transcription and simultaneously enhances its proteolytic degradation.
23760207 Studies indicate that ZNF395 was strongly expressed in adipocytes, and suggest a role for ZNF395 as a modulator of adipogenesis.
23142027 ZNF395 coordinate the transcriptional regulatory pathway with PPARG2, which may be necessary for the genesis of adipocytes.
19018758 colocalization of PBF and Scythe/BAT3 in the nucleus might be an important factor for survival of osteosarcoma cells.
17897615 PBF binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex
17531190 PBF is a new cellular factor mediating the effects of PI3K/Akt signaling and 14-3-3 on cell growth
15289353 PBF is an osteosarcoma-associated antigen recognized by autologous cytotoxic T-lymphocyte clone in the context of HLA-B*5502.
14625278 HDBP1 and HDBP2 are novel transcription factors shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells

AA Sequence

MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGL      1 - 70
QQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPG     71 - 140
AQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDIS    141 - 210
DSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMY    211 - 280
KCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPT    281 - 350
SEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPV    351 - 420
SPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVY    421 - 490
GIEHRDQWCTACRWKKACQRFLD                                                   491 - 513
//

Text Mined References (17)

PMID Year Title
24599008 2014 MiR-525-3p enhances the migration and invasion of liver cancer cells by downregulating ZNF395.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086395 2013 The hypoxia-inducible transcription factor ZNF395 is controlled by I?B kinase-signaling and activates genes involved in the innate immune response and cancer.
23760207 2013 Emerging roles of zinc finger proteins in regulating adipogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142027 2013 Identification of ZNF395 as a novel modulator of adipogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19018758 2009 Scythe/BAT3 regulates apoptotic cell death induced by papillomavirus binding factor in human osteosarcoma.
17897615 2007 Papillomavirus binding factor binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex.
More...