Property Summary

NCBI Gene PubMed Count 18
PubMed Score 36.96
PubTator Score 10.79

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MRLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLAALVIRISCHTDCRRRPGKK      1 - 70
FLQDRESSSDSSDSEDGSEDTVSDLSVRRHRRFERTLNKNVFTSAEELERAQRLEERERIIREIWMNGQP     71 - 140
EVPGTRSLNRYY                                                              141 - 152
//

Text Mined References (20)

PMID Year Title