Property Summary

NCBI Gene PubMed Count 12
Grant Count 14
R01 Count 4
Funding $1,993,000.28
PubMed Score 26.60
PubTator Score 4.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma -1.073 0.000
Alzheimer's disease -1.100 0.026
Pick disease -1.200 0.000
ovarian cancer 1.400 0.000
pituitary cancer 1.400 0.000

Gene RIF (3)

PMID Text
24870804 CARP is a potential tumor suppressor of gastric carcinoma and the rs2297882 C>T phenotype of CARP may serve as a predictor of gastric carcinoma.
21499297 results indicated that C10ORF97 functions as a novel tumor suppressor by modulating several key G(1)/S-regulatory proteins by interacting with JAB1
12054670 CARP is a novel caspase recruitment domain containing pro-apoptotic protein. (CARP, CARD containing Protein)

AA Sequence

MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE      1 - 70
KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALA     71 - 140
VEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLID    141 - 210
PVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW    211 - 280
IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK    281 - 350
LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP    351 - 420
IKRCLQTKWPYIELLWTTDRSPSLN                                                 421 - 445
//

Text Mined References (17)

PMID Year Title
27292798 2016 MINDY-1 Is a Member of an Evolutionarily Conserved and Structurally Distinct New Family of Deubiquitinating Enzymes.
25416956 2014 A proteome-scale map of the human interactome network.
24870804 2014 CARP is a potential tumor suppressor in gastric carcinoma and a single-nucleotide polymorphism in CARP gene might increase the risk of gastric carcinoma.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21499297 2011 C10ORF97 is a novel tumor-suppressor gene of non-small-cell lung cancer and a functional variant of this gene increases the risk of non-small-cell lung cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17652099 2007 Genome-wide mapping of modifier chromosomal loci for human hypertrophic cardiomyopathy.
More...