Property Summary

NCBI Gene PubMed Count 12
PubMed Score 27.74
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
Alzheimer's disease -1.100 2.6e-02
malignant mesothelioma -1.200 5.9e-05
osteosarcoma -1.073 6.1e-05
ovarian cancer 1.400 3.9e-04
Pick disease -1.200 6.0e-05
pituitary cancer 1.400 5.4e-05

Gene RIF (3)

AA Sequence

MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSE      1 - 70
KSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALA     71 - 140
VEELGFERFHALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLID    141 - 210
PVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIW    211 - 280
IVGSETHLTVFFAKDMALVAPEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK    281 - 350
LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTP    351 - 420
IKRCLQTKWPYIELLWTTDRSPSLN                                                 421 - 445
//

Text Mined References (17)

PMID Year Title