Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.83
PubTator Score 3.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.300 0.003
ependymoma -1.400 0.000
oligodendroglioma -1.300 0.011
osteosarcoma 1.582 0.000
glioblastoma -1.900 0.001
atypical teratoid / rhabdoid tumor -2.000 0.001
sonic hedgehog group medulloblastoma -1.500 0.023
primitive neuroectodermal tumor -1.500 0.024
adult high grade glioma -1.800 0.003
pilocytic astrocytoma -2.000 0.000
lung carcinoma 1.600 0.000
psoriasis -1.100 0.000

Gene RIF (1)

PMID Text
21269563 Examines the expression of ZMAT4 mRNA in the samples with 1 or 2 copies of DNA, and observed a weak yet positive correlation between the relative expression level and gene dosage.

AA Sequence

MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADM      1 - 70
VDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLKPPRMDTAPVVASPYQR     71 - 140
RDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSI    141 - 210
EQYHAHLKGSKHQTNLKNK                                                       211 - 229
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
21269563 2011 The association between the copy-number variations of ZMAT4 and hematological malignancy.
17903298 2007 Genome-wide association with diabetes-related traits in the Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.