Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.83
PubTator Score 3.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 2.6e-03
astrocytic glioma -1.300 2.6e-03
Astrocytoma, Pilocytic -2.000 7.4e-06
atypical teratoid / rhabdoid tumor -2.000 7.4e-04
ependymoma -1.200 1.4e-02
glioblastoma -1.800 1.5e-06
lung carcinoma 1.600 2.1e-06
malignant mesothelioma -1.600 5.7e-06
medulloblastoma -1.400 1.1e-02
oligodendroglioma -1.300 1.1e-02
osteosarcoma 1.582 2.6e-04
primitive neuroectodermal tumor -1.500 2.4e-02
psoriasis -1.100 8.9e-07

Gene RIF (1)

AA Sequence

MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADM      1 - 70
VDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLKPPRMDTAPVVASPYQR     71 - 140
RDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSI    141 - 210
EQYHAHLKGSKHQTNLKNK                                                       211 - 229
//

Text Mined References (7)

PMID Year Title