Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.83
PubTator Score 3.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Refractive Errors 18
Disease Target Count P-value
psoriasis 6685 8.85529848305648E-7
lung carcinoma 2844 2.06100260525454E-6
malignant mesothelioma 3163 5.74618665073474E-6
pilocytic astrocytoma 3086 7.44820037982417E-6
ependymoma 2514 8.13163452395695E-5
osteosarcoma 7933 2.58134622666346E-4
glioblastoma 5572 6.13549425311667E-4
atypical teratoid / rhabdoid tumor 4369 7.39696529601462E-4
astrocytic glioma 2241 0.00255008996625346
adult high grade glioma 2148 0.0025828864527116
oligodendroglioma 2849 0.0106951597200354
sonic hedgehog group medulloblastoma 1482 0.0225895227394504
primitive neuroectodermal tumor 3031 0.023637716734157
Disease Target Count Z-score Confidence
Refractive error 43 0.0 2.0
Type 2 diabetes mellitus 192 0.0 2.0
Disease Target Count Z-score Confidence
Myopia 99 3.494 1.7

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
astrocytic glioma -1.300 0.003
ependymoma -1.400 0.000
oligodendroglioma -1.300 0.011
osteosarcoma 1.582 0.000
glioblastoma -1.900 0.001
atypical teratoid / rhabdoid tumor -2.000 0.001
sonic hedgehog group medulloblastoma -1.500 0.023
primitive neuroectodermal tumor -1.500 0.024
adult high grade glioma -1.800 0.003
pilocytic astrocytoma -2.000 0.000
lung carcinoma 1.600 0.000
psoriasis -1.100 0.000

Synonym

Accession Q9H898 Q8WUT8
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
21269563 Examines the expression of ZMAT4 mRNA in the samples with 1 or 2 copies of DNA, and observed a weak yet positive correlation between the relative expression level and gene dosage.

AA Sequence

MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRLRSENGSDADM      1 - 70
VDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLKPPRMDTAPVVASPYQR     71 - 140
RDSDRYCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSI    141 - 210
EQYHAHLKGSKHQTNLKNK                                                       211 - 229
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
21269563 2011 The association between the copy-number variations of ZMAT4 and hematological malignancy.
17903298 2007 Genome-wide association with diabetes-related traits in the Framingham Heart Study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.