Property Summary

NCBI Gene PubMed Count 11
PubMed Score 39.53
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytic glioma -1.500 0.045
psoriasis -1.300 0.002
osteosarcoma -1.328 0.006
posterior fossa group A ependymoma -1.200 0.000
glioblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell 1.200 0.001
ulcerative colitis -1.527 0.034
hereditary spastic paraplegia -1.145 0.017
non-small cell lung cancer 1.075 0.000
lung cancer 1.500 0.000
adult high grade glioma -1.400 0.001
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -2.125 0.008
spina bifida -1.582 0.022
ovarian cancer -1.200 0.001

Gene RIF (3)

PMID Text
24057215 The study identifies a miR-138-RMND5A-Exportin-5 as a previously unknown miRNA processing regulatory pathway in HeLa cells.
22681319 Duplications of this region involving RMND5A, whose product contains a C-terminal to lis homology (LisH) domain, have not previously been associated with a defined phenotype but may present insight into encephalocele formation.
17467196 RanBPM, ARMC8alpha, ARMC8beta, Muskelin, p48EMLP, and p44CTLH form complexes in cells.

AA Sequence

MDQCVTVERELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKD      1 - 70
TVQKLASDHKDIHSSVSRVGKAIDKNFDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAEELCQ     71 - 140
ESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNREMLIAQNSSLEFKLHRLYFISLLMGGTTNQ    141 - 210
REALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDACALLGLSVES    211 - 280
PLSVSFSAGCVALPALINIKAVIEQRQCTGVWNQKDELPIEVDLGKKCWYHSIFACPILRQQTTDNNPPM    281 - 350
KLVCGHIISRDALNKMFNGSKLKCPYCPMEQSPGDAKQIFF                                 351 - 391
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24057215 2014 MiR-138 downregulates miRNA processing in HeLa cells by targeting RMND5A and decreasing Exportin-5 stability.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681319 2012 Novel neurodevelopmental disorder in the case of a giant occipitoparietal meningoencephalocele.
17467196 2007 RanBPM, Muskelin, p48EMLP, p44CTLH, and the armadillo-repeat proteins ARMC8alpha and ARMC8beta are components of the CTLH complex.
17452337 2007 ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...