Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 7.63774266438415E-14
chronic lymphocytic leukemia 244 1.16062233030145E-4
lung cancer 4473 1.67114534218544E-4
subependymal giant cell astrocytoma 2287 0.0082701648274316
gastric carcinoma 832 0.0143508500644056
interstitial cystitis 2299 0.0287048853517758

Expression

  Differential Expression (6)

Disease log2 FC p
chronic lymphocytic leukemia 1.510 0.000
non-small cell lung cancer 1.305 0.000
lung cancer 1.400 0.000
interstitial cystitis 1.100 0.029
subependymal giant cell astrocytoma 1.372 0.008
gastric carcinoma 1.800 0.014

Synonym

Accession Q9H825 Q53TM9 Q53TQ0
Symbols TIP

Gene

PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

AA Sequence

MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSA      1 - 70
VRVLLEEQVKYEREASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHVKTSATNR     71 - 140
FSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRILEVGCGAGNS    141 - 210
VFPILNTLENSPESFLYCCDFASGAVELVKSHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVFVL    211 - 280
SSIHPDRTLFI                                                               281 - 291
//

Text Mined References (9)

PMID Year Title
22745009 2012 Multiple loci influencing hippocampal degeneration identified by genome scan.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15992539 2005 TIPs are tension-responsive proteins involved in myogenic versus adipogenic differentiation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.