Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.510 0.000
non-small cell lung cancer 1.305 0.000
lung cancer 1.400 0.000
interstitial cystitis 1.100 0.029
subependymal giant cell astrocytoma 1.372 0.008
gastric carcinoma 1.800 0.014

AA Sequence

MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSA      1 - 70
VRVLLEEQVKYEREASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHVKTSATNR     71 - 140
FSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRILEVGCGAGNS    141 - 210
VFPILNTLENSPESFLYCCDFASGAVELVKSHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVFVL    211 - 280
SSIHPDRTLFI                                                               281 - 291
//

Text Mined References (9)

PMID Year Title
22745009 2012 Multiple loci influencing hippocampal degeneration identified by genome scan.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15992539 2005 TIPs are tension-responsive proteins involved in myogenic versus adipogenic differentiation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.