Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.510 1.2e-04
gastric carcinoma 1.800 1.4e-02
interstitial cystitis 1.100 2.9e-02
lung cancer 1.400 1.7e-04
non-small cell lung cancer 1.305 7.6e-14
subependymal giant cell astrocytoma 1.372 8.3e-03

Gene RIF (1)

AA Sequence

MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSA      1 - 70
VRVLLEEQVKYEREASKYWDTFYKIHKNKFFKDRNWLLREFPEILPVDQKPEEKARESSWDHVKTSATNR     71 - 140
FSRMHCPTVPDEKNHYEKSSGSSEGQSKTESDFSNLDSEKHKKGPMETGLFPGSNATFRILEVGCGAGNS    141 - 210
VFPILNTLENSPESFLYCCDFASGAVELVKSHSSYRATQCFAFVHDVCDDGLPYPFPDGILDVILLVFVL    211 - 280
SSIHPDRTLFI                                                               281 - 291
//

Text Mined References (10)

PMID Year Title