Property Summary

NCBI Gene PubMed Count 33
Grant Count 12
R01 Count 10
Funding $661,300.16
PubMed Score 33.31
PubTator Score 20.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 0.000

Gene RIF (21)

PMID Text
24467603 Four single nucleotide polymorphisms in two genes in the PGE2 family, PTGES2 and PTGER4, were significantly associated with primary graft dysfunction after lung transplantation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19664621 high immunoreactivity of mPGES-2 in pyramidal neurons of AD brains indicates that it might have a potential role in the functional replacement of cytosolic PGES or inactive mPGES-1 in later stages of Alzheimer disease
19412621 These results indicate that mPGES-1 and mPGES-2 may each play a role in colorectal cancer progression.
19371221 A marginal but significant influence of the PTGES2 298H single nucleotide polymorphism on BMI was found in a large population-based study.
19371221 Observational study of gene-disease association. (HuGE Navigator)
19347995 all three terminal prostaglandin synthases, mPGES-1, mPGES-2, and cPGES, are over-expressed in human gliomas
19336370 Observational study of gene-disease association. (HuGE Navigator)
19268562 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLGAAALALGGAL      1 - 70
GLYHTARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEI     71 - 140
KFSSYRKVPILVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYW    141 - 210
LMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKY    211 - 280
MGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAF    281 - 350
DDLMQHTHIQPWYLRVERAITEASPAH                                               351 - 377
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24467603 2014 Genetic variation in the prostaglandin E2 pathway is associated with primary graft dysfunction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
19664621 2010 Microsomal prostaglandin E synthase-2: cellular distribution and expression in Alzheimer's disease.
19412621 2009 Microsomal prostaglandin E synthase protein levels correlate with prognosis in colorectal cancer patients.
More...