Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.42
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 2.7e-03
atypical teratoid / rhabdoid tumor 1.100 5.6e-04
glioblastoma -1.100 1.1e-04
lung cancer -1.200 2.8e-04
medulloblastoma, large-cell 1.300 1.2e-05
osteosarcoma 1.364 7.5e-05
ovarian cancer 2.000 2.6e-12
spina bifida -1.183 4.1e-02
tuberculosis -1.100 8.8e-04

Gene RIF (2)

AA Sequence

MEEKTQIKTFLGSKLPKYGTKSVRSTLQPMPNGTPVNLLGTSKNSNVKSYIKNNGSDCPSSHSFNWRKAN      1 - 70
KYQLCAQGVEEPNNTQNSHDKIIDPEKRVPTQGMFDKNGIKGGLKSVSLFTSKLAKPSTMFVSSTEELNQ     71 - 140
KSFSGPSNLGKFTKGTLLGRTSYSSINTPKSQLNGFYGNRSAGSMQRPRANSCATRSSSGESLAQSPDSS    141 - 210
KSINCEKMVRSQSFSHSIQNSFLPPSSITRSHSFNRAVDLTKPYQNQQLSIRVPLRSSMLTRNSRQPEVL    211 - 280
NGNEHLGYGFNRPYAAGGKKLALPNGPGVTSTLGYRMVHPSLLKSSRSPFSGTMTVDGNKNSPADTCVEE    281 - 350
DATVLAKDRAANKDQELIENESYRTKNNQTMKHDAKMRYLSDDVDDISLSSLSSSDKNDLSEDFSDDFID    351 - 420
IEDSNRTRITPEEMSLKEEKHENGPPQDMFDSPKENEKAFSKTDEWIDISVSDRSECTKHTSGNNLVSPD    421 - 490
TDYRAGSSFELSPSDSSDGTYMWDEEGLEPIGNVHPVGSYESSEMNSIDILNNLESCDLEDDDLMLDVDL    491 - 560
PEDAPLENVECDNMNRFDRPDRNVRQPQEGFWKRPPQRWSGQEHYHLSHPDHYHHHGKSDLSRGSPYRES    561 - 630
PLGHFESYGGMPFFQAQKMFVDVPENTVILDEMTLRHMVQDCTAVKTQLLKLKRLLHQHDGSGSLHDIQL    631 - 700
SLPSSPEPEDGDKVYKNEDLLNEIKQLKDEIKKKDEKIQLLELQLATQHICHQKCKEEKCTYADKYTQTP    701 - 770
WRRIPGGYSAPSFSPWQGSFQGIPRTVPPHRRQTSSTTAFQQPSQTHRSHPGKTNKATTYRGPQ          771 - 834
//

Text Mined References (10)

PMID Year Title