Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.84
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.9e-139

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 1.9e-139

Gene RIF (1)

AA Sequence

MRRTGPEEEACGVWLDAAALKRRKVQTHLIKPGTKMLTLLPGERKANIYFTQRRAPSTGIHQRSIASFFT      1 - 70
LQPGKTNGSDQKSVSSHTESQINKESKKNATQLDHLIPGLAHDCMASPLATSTTADIQEAGLSPQSLQTS     71 - 140
GHHRMKTPFSTELSLLQPDTPDCAGDSHTPLAFSFTEDLESSCLLDRKEEKGDSARKWEWLHESKKNYQS    141 - 210
MEKHTKLPGDKCCQPLGKTKLERKVSAKENRQAPVLLQTYRESWNGENIESVKQSRSPVSVFSWDNEKND    211 - 280
KDSWSQLFTEDSQGQRVIAHNTRAPFQDVTNNWNWDLGPFPNSPWAQCQEDGPTQNLKPDLLFTQDSEGN    281 - 350
QVIRHQF                                                                   351 - 357
//

Text Mined References (10)

PMID Year Title