Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.05
PubTator Score 1.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.740 5.3e-03
active ulcerative colitis 1.528 1.3e-02
ductal carcinoma in situ 1.600 3.8e-02
head and neck cancer 1.300 5.5e-03
intraductal papillary-mucinous adenoma (... 1.600 9.1e-03
intraductal papillary-mucinous neoplasm ... 2.300 6.9e-03
lung adenocarcinoma 1.100 2.1e-04
lung carcinoma -1.300 5.7e-08
psoriasis 2.100 1.6e-65

Gene RIF (1)

AA Sequence

MESPLIYVSVLLLNIFEFSSGIVYNKDDTEKRFACSNKGFPQENEIIKLYLFLENLKIQCFFQTENEIAS      1 - 70
KAMLSVFTSGGLAPSLGIMNSTYNGIFHFNLTLFSDRILWLVDIPRENITQSTDIAAVEEWLVRITLHHG     71 - 140
LNIYATEGTLLDVIREPILQWTPGDVIPESEISKLYPHVVDLKVTKCPCANDVALLGFIVDTIVDGVYIG    141 - 210
ITFGGFWHDYDTTWFNMTQTIYSQLQEEYEDLSLVDMVLTNHFLVILTSLGLFVSEDLRYPSRHSLSFSR    211 - 280
ADFCGFERVDYVKGKLWYNERCFANREHFEVDYVTVTFERNRTLSESSSCFYSQEPFLEWVPCLPHIFKG    281 - 350
IKIFPTVLTFLVDQERGTGVYLFYNKVRKTAIASVSTLRNNEPNSQSKFPIFRFPSSFSSPVGMVFHPRS    351 - 420
HFLYAYGNQIWLSVDGGNTFQLIANFHDDIIKKTFHSFYTSAITFVSQRGKVYSTKAGMGRYSAVGSVTE    421 - 490
RIFTLYYDHLGFLHKLTLGRFEASGPPTAFGNSRNLFGQPPDMGFETALAPQHTSLDEIIFFAYVPENEP    491 - 560
QETIYSKKFGNIHYGKVIHSGKTGRAYIRKVLQHTTPKGFLSSVIAEMKEPFGLEEVNESSCLSSSLLIN    561 - 630
KAGNVYKLTLDSQVVQALFEDTDIEKTVVLPGYSSFLITSILDNKNALAIATMPESAPNNMTFLKSTWFL    631 - 700
YNFGQRNGRTWKIYSKPCNYWFQHDDSPSLNIVKYIDLGNSYVLKAKVIRNAKGFRMLEIPLLTVFVGNP    701 - 770
NLLEVTAEVTFDDTDSYVITISAASKVLHQGSTSLAFIMWSASTECFVTTMVPTLKSSCSYLRSMHHIPS    771 - 840
KFIPFEDWISGVHKDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQ    841 - 910
CANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINEDGRVPLQSPYLVTVTEVNMR    911 - 980
HNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKGSELFHFRVTVISGVTFCNLIEEFQIYVDEA    981 - 1050
PLPFPGHTLIAVATAVVLGGLIFIAFMFQLQGIHPWRTFQRWIRRNQEKFSSISLSELIHRSKSEE       1051 - 1116
//

Text Mined References (8)

PMID Year Title