Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.05
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.22737820974532E-13
atypical teratoid / rhabdoid tumor 4369 1.67053060808968E-9
pediatric high grade glioma 2712 9.99963928204463E-8
pilocytic astrocytoma 3086 1.89741940433719E-7
malignant mesothelioma 3163 1.64209630954055E-6
glioblastoma 5572 3.81708498679368E-6
ovarian cancer 8492 1.0862878780925E-5
psoriasis 6685 1.74765655094688E-4
primitive neuroectodermal tumor 3031 9.95752236071235E-4
sonic hedgehog group medulloblastoma 1482 0.00395886532150712
colon cancer 1475 0.0303264151988299
astrocytic glioma 2241 0.035153443552289

Expression

  Differential Expression (12)

Synonym

Accession Q9H7F4 A8K1G5 Q53T33 Q66K44 Q8IZ77
Symbols FAM11B

Gene

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (1)

PMID Text
15525354 The mouse ee3 is an orphan G-protein-coupled receptor with potential connections to erythropoietin and 5HT2a receptor signalling. ee3_2, a similar gene, is also described, along with human orthologs.

AA Sequence

MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASVGAGVWARNPR      1 - 70
YRTEGEACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLFFVSPVSVAACVWGFRHDRSL     71 - 140
ELEILCSVNILQFIFIALKLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTH    141 - 210
VTMAISWITIVVPLLTFEVLLVHRLDGHNTFSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQ    211 - 280
FLLEIFPFLREYGNISYDLHHEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD    281 - 350
//

Text Mined References (7)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15525354 2004 Cloning of a novel neuronally expressed orphan G-protein-coupled receptor which is up-regulated by erythropoietin, interacts with microtubule-associated protein 1b and colocalizes with the 5-hydroxytryptamine 2a receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12404111 2002 A novel gene, FAM11A, associated with the FRAXF CpG island is transcriptionally silent in FRAXF full mutation.