Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 1.26022318358389E-4
ovarian cancer 8492 0.00169652744358205
colon cancer 1475 0.00288548957822773
astrocytoma 1493 0.0146477792309842

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.100 0.015
colon cancer 1.400 0.003
nasopharyngeal carcinoma 1.300 0.000
ovarian cancer 1.600 0.002

Synonym

Accession Q9H7E9 A6NGC0 Q96BT8
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKK      1 - 70
QKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIG     71 - 140
AIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSI    141 - 210
WRAKATLDMPDEEFRFNFF                                                       211 - 229
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19060904 2009 An empirical framework for binary interactome mapping.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...