Property Summary

NCBI Gene PubMed Count 7
PubMed Score 74.53
PubTator Score 16.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-03
group 3 medulloblastoma 1.400 3.5e-04
primitive neuroectodermal tumor 1.200 7.5e-04
psoriasis -1.200 9.1e-03

Gene RIF (1)

AA Sequence

MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDIL      1 - 70
SPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKE     71 - 140
DAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQ    141 - 210
KKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLT    211 - 280
LSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYAD    281 - 350
ICEWRKGSGVLSSTLAPQVKKAK                                                   351 - 373
//

Text Mined References (9)

PMID Year Title