Property Summary

NCBI Gene PubMed Count 7
Grant Count 4
Funding $122,859
PubMed Score 70.55
PubTator Score 16.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 0.009
primitive neuroectodermal tumor 1.200 0.001
adult high grade glioma -1.100 0.001
group 3 medulloblastoma 1.400 0.000

Synonym

Accession Q9H790 D3DPV4 Q5SWM7 Q5SWM8 Q5SWM9 Q5SWN0 Q5SWN1 Q8WTW9 Exo V
Symbols DEM1
Exo V
hExo5
C1orf176

Gene

Gene RIF (1)

PMID Text
23095756 The human homolog (C1orf176; EXO5) that functions in the repair of nuclear DNA damage.

AA Sequence

MAETREEETVSAEASGFSDLSDSEFLEFLDLEDAQESKALVNMPGPSSESLGKDDKPISLQNWKRGLDIL      1 - 70
SPMERFHLKYLYVTDLATQNWCELQTAYGKELPGFLAPEKAAVLDTGASIHLARELELHDLVTVPVTTKE     71 - 140
DAWAIKFLNILLLIPTLQSEGHIREFPVFGEGEGVLLVGVIDELHYTAKGELELAELKTRRRPMLPLEAQ    141 - 210
KKKDCFQVSLYKYIFDAMVQGKVTPASLIHHTKLCLEKPLGPSVLRHAQQGGFSVKSLGDLMELVFLSLT    211 - 280
LSDLPVIDILKIEYIHQETATVLGTEIVAFKEKEVRAKVQHYMAYWMGHREPQGVDVEEAWKCRTCTYAD    281 - 350
ICEWRKGSGVLSSTLAPQVKKAK                                                   351 - 373
//

Text Mined References (9)

PMID Year Title
23095756 2012 Human exonuclease 5 is a novel sliding exonuclease required for genome stability.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.