Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.14
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.016 1.0e-03
ductal carcinoma in situ 1.200 9.3e-04
ependymoma -1.200 1.9e-07
gastric cancer 1.200 3.0e-03
hepatocellular carcinoma 1.100 7.4e-06
intraductal papillary-mucinous carcinoma... 1.200 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 9.6e-03
lung adenocarcinoma -1.100 1.4e-12
lung carcinoma -1.300 2.7e-22
medulloblastoma, large-cell 1.200 1.2e-04
non-small cell lung cancer -1.165 6.0e-20
osteosarcoma 2.120 3.5e-07
ovarian cancer 1.500 2.1e-11

Synonym

Accession Q9H741 Q53GE8
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSR      1 - 70
PSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNK     71 - 140
QLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA         141 - 205
//

Text Mined References (7)

PMID Year Title