Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.90
PubTator Score 0.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
urothelial carcinoma -2.900 0.000
esophageal adenocarcinoma -2.500 0.023
psoriasis 1.400 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.029
colon cancer -4.200 0.000
active Crohn's disease -1.551 0.035
active ulcerative colitis -4.262 0.005
interstitial cystitis -3.100 0.000
posterior fossa group B ependymoma 1.200 0.031
gastric carcinoma -2.300 0.012

AA Sequence

MPSLWREILLESLLGCVSWSLYHDLGPMIYYFPLQTLELTGLEGFSIAFLSPIFLTITPFWKLVNKKWML      1 - 70
TLLRIITIGSIASFQAPNAKLRLMVLALGVSSSLIVQAVTWWSGSHLQRYLRIWGFILGQIVLVVLRIWY     71 - 140
TSLNPIWSYQMSNKVILTLSAIATLDRIGTDGDCSKPEEKKTGEVATGMASRPNWLLAGAAFGSLVFLTH    141 - 210
WVFGEVSLVSRWAVSGHPHPGPDPNPFGGAVLLCLASGLMLPSCLWFRGTGLIWWVTGTASAAGLLYLHT    211 - 280
WAAAVSGCVFAIFTASMWPQTLGHLINSGTNPGKTMTIAMIFYLLEIFFCAWCTAFKFVPGGVYARERSD    281 - 350
VLLGTMMLIIGLNMLFGPKKNLDLLLQTKNSSKVLFRKSEKYMKLFLWLLVGVGLLGLGLRHKAYERKLG    351 - 420
KVAPTKEVSAAIWPFRFGYDNEGWSSLERSAHLLNETGADFITILESDASKPYMGNNDLTMWLGEKLGFY    421 - 490
TDFGPSTRYHTWGIMALSRYPIVKSEHHLLPSPEGEIAPAITLTVNISGKLVDFVVTHFGNHEDDLDRKL    491 - 560
QAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVKDIDSTDHDRWCEYIMYRGLIRLGYARISH    561 - 630
AELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYFL     631 - 699
//

Text Mined References (8)

PMID Year Title
22095909 2012 Serum ferritin levels are associated with a distinct phenotype of chronic hepatitis C poorly responding to pegylated interferon-alpha and ribavirin therapy.
17761529 2007 Saccharomyces cerevisiae CWH43 is involved in the remodeling of the lipid moiety of GPI anchors to ceramides.
17714445 2007 CWH43 is required for the introduction of ceramides into GPI anchors in Saccharomyces cerevisiae.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.