Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.47
PubTator Score 0.74

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease -1.551 3.5e-02
active ulcerative colitis -3.296 7.0e-03
colon cancer -4.200 4.2e-04
esophageal adenocarcinoma -2.200 3.2e-02
gastric carcinoma -1.900 6.9e-03
interstitial cystitis -2.700 3.1e-04
intraductal papillary-mucinous adenoma (... 1.100 2.9e-02
posterior fossa group B ependymoma 1.200 3.1e-02
psoriasis 1.100 1.4e-04
urothelial carcinoma -2.900 3.0e-04

AA Sequence

MPSLWREILLESLLGCVSWSLYHDLGPMIYYFPLQTLELTGLEGFSIAFLSPIFLTITPFWKLVNKKWML      1 - 70
TLLRIITIGSIASFQAPNAKLRLMVLALGVSSSLIVQAVTWWSGSHLQRYLRIWGFILGQIVLVVLRIWY     71 - 140
TSLNPIWSYQMSNKVILTLSAIATLDRIGTDGDCSKPEEKKTGEVATGMASRPNWLLAGAAFGSLVFLTH    141 - 210
WVFGEVSLVSRWAVSGHPHPGPDPNPFGGAVLLCLASGLMLPSCLWFRGTGLIWWVTGTASAAGLLYLHT    211 - 280
WAAAVSGCVFAIFTASMWPQTLGHLINSGTNPGKTMTIAMIFYLLEIFFCAWCTAFKFVPGGVYARERSD    281 - 350
VLLGTMMLIIGLNMLFGPKKNLDLLLQTKNSSKVLFRKSEKYMKLFLWLLVGVGLLGLGLRHKAYERKLG    351 - 420
KVAPTKEVSAAIWPFRFGYDNEGWSSLERSAHLLNETGADFITILESDASKPYMGNNDLTMWLGEKLGFY    421 - 490
TDFGPSTRYHTWGIMALSRYPIVKSEHHLLPSPEGEIAPAITLTVNISGKLVDFVVTHFGNHEDDLDRKL    491 - 560
QAIAVSKLLKSSSNQVIFLGYITSAPGSRDYLQLTEHGNVKDIDSTDHDRWCEYIMYRGLIRLGYARISH    561 - 630
AELSDSEIQMAKFRIPDDPTNYRDNQKVVIDHREVSEKIHFNPRFGSYKEGHNYENNHHFHMNTPKYFL     631 - 699
//

Text Mined References (8)

PMID Year Title