Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.55
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (4)

AA Sequence

MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSL      1 - 70
TNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSI     71 - 140
GSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLI    141 - 210
RRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYE    211 - 280
DIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM                             281 - 325
//

Text Mined References (14)

PMID Year Title