Property Summary

NCBI Gene PubMed Count 10
Grant Count 2
Funding $102,732
PubMed Score 6.89
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9H6V9 B7ZA47 B7ZAJ5 D6W530 E7ESN0 Q53T37 Q53T58
Symbols hLDAH
C2orf43

Gene

 Grant Application (2)

Gene RIF (4)

PMID Text
24357060 The data identify lipid droplet-associated serine hydrolase (LDAH) a candidate target to promote reverse cholesterol transport from atherosclerotic lesions.
22662242 Our results provide further support for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in Eastern Asian populations
20676098 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDSELKEEIPVHEEFILCGGAETQVLKCGPWTDLFHDQSVKRPKLLIFIIPGNPGFSAFYVPFAKALYSL      1 - 70
TNRRFPVWTISHAGHALAPKDKKILTTSEDSNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSI     71 - 140
GSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLYVTGYLLLKPCPETIKSLLI    141 - 210
RRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYE    211 - 280
DIKKDFPEGDIRLCEKNIPHAFITHFNQEMADMIADSLKDDLSKM                             281 - 325
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24357060 2014 Novel lipid droplet-associated serine hydrolase regulates macrophage cholesterol mobilization.
22662242 2012 Replication and fine mapping for association of the C2orf43, FOXP4, GPRC6A and RFX6 genes with prostate cancer in the Chinese population.
21269460 2011 Initial characterization of the human central proteome.
21059979 2010 Familial defective apolipoprotein B-100 and increased low-density lipoprotein cholesterol and coronary artery calcification in the old order amish.
20676098 2010 Genome-wide association study identifies five new susceptibility loci for prostate cancer in the Japanese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17135363 2007 Roles and origins of leukocyte lipid bodies: proteomic and ultrastructural studies.
More...