Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
acute myeloid leukemia 780

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.100 0.003

Synonym

Accession Q9H6D7 B7WP17 D3DS34 Q86T15 Q86T16 Q86U43 Q9NX59
Symbols C14orf94

Gene

AA Sequence

MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKE      1 - 70
VRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLL     71 - 140
GLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQ    141 - 210
QQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLR    211 - 280
MEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATEN    281 - 350
KRWALQEFSKVYR                                                             351 - 363
//

Text Mined References (9)

PMID Year Title
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.