Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
acute myeloid leukemia 783 2.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Joubert syndrome 66 3.989 2.0
primary open angle glaucoma 16 3.196 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.100 2.5e-03

AA Sequence

MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKE      1 - 70
VRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLL     71 - 140
GLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQ    141 - 210
QQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLR    211 - 280
MEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATEN    281 - 350
KRWALQEFSKVYR                                                             351 - 363
//

Text Mined References (12)

PMID Year Title