Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 2.1e-07
medulloblastoma, large-cell -1.100 5.9e-05

AA Sequence

MHNPDGSASPTADPGSELQTLGQAARRPPPPRAGHDAPRRTRPSARKPLSCFSRRPMPTREPPKTRGSRG      1 - 70
HLHTHPPGPGPPLQGLAPRGLKTSAPRPPCQPQPGPHKAKTKKIVFEDELLSQALLGAKKPIGAIPKGHK     71 - 140
PRPHPVPDYELKYPPVSSERERSRYVAVFQDQYGEFLELQHEVGCAQAKLRQLEALLSSLPPPQSQKEAQ    141 - 210
VAARVWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF                    211 - 264
//

Text Mined References (4)

PMID Year Title