Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9H606
Symbols CYorf17

Gene

 Compartment GO Term (1)

AA Sequence

MMRRSPSGLKSPRVSQGRKPRDPESLLFLRCCLGSEPHNLSSLLSPEAGQEPLPKLLPQPLAGHAAWGIH      1 - 70
GVPTSLLLAGECWGQGMAVPADPPPASPYRTSPRPPPGPLPRYRPQQHLLLPLGRLHALCPGCPLQQSLQ     71 - 140
FERGTLSAPRLWSWMKLETIILSKLSQGQKTKHRMFSLISES                                141 - 182
//

Text Mined References (2)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.