Property Summary

NCBI Gene PubMed Count 22
Grant Count 16
R01 Count 13
Funding $1,156,259.93
PubMed Score 19.40
PubTator Score 23.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.780 0.004
psoriasis 1.100 0.002
group 3 medulloblastoma 1.700 0.006
pancreatic ductal adenocarcinoma liver m... -2.110 0.002
non-small cell lung cancer 1.065 0.000
lung cancer 2.000 0.006
lung adenocarcinoma 1.035 0.000
ovarian cancer 1.700 0.000
dermatomyositis 1.400 0.001

Gene RIF (12)

PMID Text
24413562 The results reveal the organization of TFAM, POLRMT and TFB2M around the light-strand promoter and represent the first structural characterization of the entire mitochondrial transcriptional initiation complex.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20410300 only two essential initiation factors, TFAM and TFB2M, and two promoters, LSP and HSP1, are required to drive transcription of the mitochondrial genome
19681768 The mRNA levels of TFB1M and TFB2M are influenced by endurance training
19624753 Promoter-independent DNA conformation-dependent transcription required TFB2M.
19417006 rRNA methyltransferase activity is necessary for induction of mitochondrial biogenesis by TFB1M, but not TFB2M.
19096125 determined the variation in the TFAM, TFB1M, and TFB2M genes in cardiac hypertrophy
19096125 Observational study of gene-disease association. (HuGE Navigator)
18980857 This study suggested that DNA variants in TFB2M did not contribute to the risk for parkinson disease.
18980857 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLD      1 - 70
FKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNL     71 - 140
DGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYD    141 - 210
LYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPL    211 - 280
ENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDI    281 - 350
LMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR                            351 - 396
//

Text Mined References (23)

PMID Year Title
24413562 2014 Organization of the human mitochondrial transcription initiation complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20410300 2010 Human mitochondrial transcription revisited: only TFAM and TFB2M are required for transcription of the mitochondrial genes in vitro.
19681768 2010 Training response of mitochondrial transcription factors in human skeletal muscle.
19624753 2009 DNA conformation-dependent activities of human mitochondrial RNA polymerase.
19417006 2009 Elucidation of separate, but collaborative functions of the rRNA methyltransferase-related human mitochondrial transcription factors B1 and B2 in mitochondrial biogenesis reveals new insight into maternally inherited deafness.
19096125 2008 Mitochondrial transcription factors TFA, TFB1 and TFB2: a search for DNA variants/haplotypes and the risk of cardiac hypertrophy.
18980857 2009 Mutational screening of the mitochondrial transcription factors B1 and B2 (TFB1M and TFB2M) in Parkinson's disease.
More...