Property Summary

NCBI Gene PubMed Count 24
PubMed Score 21.07
PubTator Score 23.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
dermatomyositis 1.400 1.5e-03
group 3 medulloblastoma 1.700 6.1e-03
lung adenocarcinoma 1.035 9.0e-05
lung cancer 2.000 5.6e-03
Multiple myeloma 1.780 4.2e-03
non-small cell lung cancer 1.065 6.2e-16
ovarian cancer 1.700 1.4e-04
pancreatic ductal adenocarcinoma liver m... -2.110 1.6e-03
psoriasis 1.100 1.9e-03

Gene RIF (14)

AA Sequence

MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLD      1 - 70
FKRYVTDRRLAETLAQIYLGKPSRPPHLLLECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNL     71 - 140
DGKLRVIHCDFFKLDPRSGGVIKPPAMSSRGLFKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYD    141 - 210
LYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPL    211 - 280
ENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDI    281 - 350
LMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR                            351 - 396
//

Text Mined References (25)

PMID Year Title