Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.89
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.401 2.5e-04
astrocytoma -1.100 2.4e-02
colon cancer 1.100 5.2e-06
group 4 medulloblastoma -1.100 1.0e-03
juvenile dermatomyositis 2.020 1.6e-13
lung cancer 1.300 6.4e-04
Multiple myeloma 1.410 1.1e-02
osteosarcoma 1.013 6.9e-03
ovarian cancer -1.600 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.918 6.1e-04
Pick disease -1.200 8.1e-06
spina bifida -1.802 4.3e-02

Synonym

Accession Q9H5J8 Q6I9Y6
Symbols JOSD3
RAFI41
TAFI41
TAF(I)41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSF      1 - 70
EPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESEN     71 - 140
EKNAPWRKILTFEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEE    141 - 210
STAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM      211 - 278
//

Text Mined References (14)

PMID Year Title