Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $39,217.67
PubMed Score 1.89
PubTator Score 0.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.410 0.011
osteosarcoma 1.013 0.007
astrocytoma -1.100 0.024
juvenile dermatomyositis 2.020 0.000
acute quadriplegic myopathy 1.401 0.000
pancreatic ductal adenocarcinoma liver m... 1.918 0.001
lung cancer 1.300 0.001
colon cancer 1.100 0.000
group 4 medulloblastoma -1.500 0.004
spina bifida -2.048 0.041
Pick disease -1.200 0.000
ovarian cancer 3.200 0.000

Synonym

Accession Q9H5J8 Q6I9Y6
Symbols JOSD3
RAFI41
TAFI41
TAF(I)41

Gene

 Grant Application (1)

 GO Function (1)

Gene RIF (2)

PMID Text
17318177 TAF(I)41 (MGC5306) is integral to transcriptionally active SL1 and plays a role in Pol I recruitment and, therefore, preinitiation complex formation in vivo.
15520167 An antigrowth activity and modulations of cell cycle events are identified in cells expressing siRNAMGC5306.

AA Sequence

MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSF      1 - 70
EPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESEN     71 - 140
EKNAPWRKILTFEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEE    141 - 210
STAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM      211 - 278
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
More...