Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.89
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.55769601036571E-13
ovarian cancer 8492 3.29224471047472E-7
colon cancer 1475 5.16064596574105E-6
Pick disease 1893 8.07025626059401E-6
acute quadriplegic myopathy 1157 2.51561203129151E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.1044891391284E-4
lung cancer 4473 6.35267501247416E-4
group 4 medulloblastoma 1875 0.00419828311229786
osteosarcoma 7933 0.00687953855755136
Multiple myeloma 1328 0.0109495897977666
astrocytoma 1493 0.0240805854309881
spina bifida 1064 0.0412572915265152

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.410 0.011
osteosarcoma 1.013 0.007
astrocytoma -1.100 0.024
juvenile dermatomyositis 2.020 0.000
acute quadriplegic myopathy 1.401 0.000
pancreatic ductal adenocarcinoma liver m... 1.918 0.001
lung cancer 1.300 0.001
colon cancer 1.100 0.000
group 4 medulloblastoma -1.500 0.004
spina bifida -2.048 0.041
Pick disease -1.200 0.000
ovarian cancer 3.200 0.000

Synonym

Accession Q9H5J8 Q6I9Y6
Symbols JOSD3
RAFI41
TAFI41
TAF(I)41

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken EggNOG Inparanoid
Xenopus OMA EggNOG

 GO Function (1)

Gene RIF (2)

PMID Text
17318177 TAF(I)41 (MGC5306) is integral to transcriptionally active SL1 and plays a role in Pol I recruitment and, therefore, preinitiation complex formation in vivo.
15520167 An antigrowth activity and modulations of cell cycle events are identified in cells expressing siRNAMGC5306.

AA Sequence

MDKSGIDSLDHVTSDAVELANRSDNSSDSSLFKTQCIPYSPKGEKRNPIRKFVRTPESVHASDSSSDSSF      1 - 70
EPIPLTIKAIFERFKNRKKRYKKKKKRRYQPTGRPRGRPEGRRNPIYSLIDKKKQFRSRGSGFPFLESEN     71 - 140
EKNAPWRKILTFEQAVARGFFNYIEKLKYEHHLKESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEE    141 - 210
STAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDITEEAALSKKRATKAKNTGQRGLKM      211 - 278
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17318177 2007 A novel TBP-associated factor of SL1 functions in RNA polymerase I transcription.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15970593 2005 TBP-TAF complex SL1 directs RNA polymerase I pre-initiation complex formation and stabilizes upstream binding factor at the rDNA promoter.
More...