Property Summary

NCBI Gene PubMed Count 11
PubMed Score 38.41
PubTator Score 59.07

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.2897036037691E-7
breast carcinoma 1614 4.00898529515586E-5
ovarian cancer 8492 6.69723032226318E-5
inflammatory breast cancer 404 1.88058362417408E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00223829913861592
oligodendroglioma 2849 0.00604427636587509
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00640254672296928
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0160975455818401



Accession Q9H4I9 B2R5D1 Q8TAB9
Symbols DDDD


  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Cow OMA Inparanoid

Pathway (1)

Gene RIF (4)

26489515 Our experiments provide novel details about how MCU/EMRE is regulated by MICU1 and an original approach to investigate MCU/EMRE activation in intact cells.
24231807 EMRE is essential for in vivo uniporter current and additionally bridges the calcium-sensing role of MICU1 and MICU2 with the calcium-conducting role of MCU.
24231807 EMRE (C22orf32) is an integral mitochondrial inner membrane protein and component of the mitochondrial uniporter complex (uniplex). It is essential for uniporter channel activity. In its absence, the pore does not interact with its regulators MICU1/2.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

FSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD                                      71 - 107

Text Mined References (16)

PMID Year Title
27642048 2016 The m-AAA Protease Associated with Neurodegeneration Limits MCU Activity in Mitochondria.
27184846 2016 MCUR1 Is a Scaffold Factor for the MCU Complex Function and Promotes Mitochondrial Bioenergetics.
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
26774479 2016 EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter.
26489515 2015 Rearrangement of MICU1 multimers for activation of MCU is solely controlled by cytosolic Ca(2.).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24231807 2013 EMRE is an essential component of the mitochondrial calcium uniporter complex.
22925203 2012 Inactivation of Pde8b enhances memory, motor performance, and protects against age-induced motor coordination decay.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.