Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.23
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
juvenile dermatomyositis -1.061 0.000
group 4 medulloblastoma -1.100 0.004

AA Sequence

MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNLPRTVTQLVAE      1 - 70
DGSRVYVVGTAHFSDDSKRDVVKTIREVQPDVVVVELCQYRVSMLKMDESTLLREAQELSLEKLQQAVRQ     71 - 140
NGLMSGLMQMLLLKVSAHITEQLGMAPGGEFREAFKEASKVPFCKFHLGDRPIPVTFKRAIAALSFWQKV    141 - 210
RLAWGLCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTYMLRQAARRLELPRAS    211 - 280
DAEPRKCVPSVVVGVVGMGHVPGIEKNWSTDLNIQEIMTVPPPSVSGRVSRLAVKAAFFGLLGYSLYWMG    281 - 350
RRTASLVLSLPAAQYCLQRVTEARHK                                                351 - 376
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25173755 2014 Integrative identification of Epstein-Barr virus-associated mutations and epigenetic alterations in gastric cancer.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12529303 2003 Reevaluating human gene annotation: a second-generation analysis of chromosome 22.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...