Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.23
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma -1.100 3.9e-03
juvenile dermatomyositis -1.061 7.3e-11
medulloblastoma, large-cell 1.100 1.1e-04

Synonym

Accession Q9H4I3 Q19CC5 Q96ED8 Q9H7N1 Q9UGX6 Q9UGX7
Symbols LP6054
PP2447

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNLPRTVTQLVAE      1 - 70
DGSRVYVVGTAHFSDDSKRDVVKTIREVQPDVVVVELCQYRVSMLKMDESTLLREAQELSLEKLQQAVRQ     71 - 140
NGLMSGLMQMLLLKVSAHITEQLGMAPGGEFREAFKEASKVPFCKFHLGDRPIPVTFKRAIAALSFWQKV    141 - 210
RLAWGLCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTYMLRQAARRLELPRAS    211 - 280
DAEPRKCVPSVVVGVVGMGHVPGIEKNWSTDLNIQEIMTVPPPSVSGRVSRLAVKAAFFGLLGYSLYWMG    281 - 350
RRTASLVLSLPAAQYCLQRVTEARHK                                                351 - 376
//

Text Mined References (12)

PMID Year Title