Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.30
PubTator Score 102.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.500 7.1e-03
Astrocytoma, Pilocytic 3.000 1.0e-06
atypical teratoid / rhabdoid tumor -1.100 1.3e-05
cystic fibrosis 1.743 1.4e-05
ependymoma 2.500 3.6e-02
group 4 medulloblastoma 1.300 2.1e-02
lung carcinoma 2.500 6.9e-13
oligodendroglioma 2.500 3.8e-03
osteosarcoma -2.232 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.184 5.0e-03

Protein-protein Interaction (5)

Gene RIF (14)

AA Sequence

MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDGRSYESMCEYQ      1 - 70
RAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGEDGSFTQVQCHTYTGYCWCVT     71 - 140
PDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKD    141 - 210
SKLNNTNIRNSEKVYSCDQERQSALEEAQQNPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPL    211 - 280
PGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRF    281 - 350
SEPDPSHTLEERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE    351 - 420
LKGCLGVSKEGRLV                                                            421 - 434
//

Text Mined References (23)

PMID Year Title