Property Summary

NCBI Gene PubMed Count 19
Grant Count 137
R01 Count 97
Funding $18,398,878.64
PubMed Score 835.71
PubTator Score 102.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q9H4F8 A8K1S3 B2R7P5 Q96F78
Symbols OAS

Gene

PANTHER Protein Class (1)

Pathway (1)

Gene RIF (11)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of SPARC related modular calcium binding 1 (SMOC1) in primary human brain microvascular endothelial cells
23333304 Microarray analysis indicates HIV-1 Tat-induced upregulation of SPARC related modular calcium binding 1 (SMOC1) in primary human brain microvascular endothelial cells
23274784 IL-17A but not IL-22 suppresses the replication of hepatitis B virus by inducing the expression of MxA and OAS.
23263445 SMOC1 provides a link between prenatal hormone exposure and digit ratio.
21750680 Homozygosity mapping and subsequent targeted mutation analysis of a locus on 14q24.2 identified homozygous mutations in SMOC1 (SPARC-related modular calcium binding 1) in eight unrelated families with Waardenburg Anophthalmia syndrome.
21349332 The present study thus identified SPARC related modular calcium binding 1 as a new cancer-associated protein capable of interacting with tenascin-C in vitro
21194680 Waardenburg anophthalmia syndrome is genetically heterogeneous; a second was locus found on chromosome 14, and mutations in SMOC1 were shown also cause this syndrome.
21194678 these findings indicate that SMOC1/Smoc1 is essential for ocular and limb development in both humans and mice.
20359165 Analyzed the secretory protein profiles of BMSCs grown in osteogenic medium (OSM) and identified SPARC-related modular calcium-binding protein 1 (SMOC1), a member of the SPARC family, as a regulator of osteoblast differentiation of BMSCs.
17386346 SMOC-1 is of physiological interest because it codes a secreted glycoprotein with five domains, each containing regions homologous to those on other proteins that mediate cell-matrix interactions.
More...

AA Sequence

MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDGRSYESMCEYQ      1 - 70
RAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGEDGSFTQVQCHTYTGYCWCVT     71 - 140
PDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSKPTPTMETQPVFDGDEITAPTLWIKHLVIKD    141 - 210
SKLNNTNIRNSEKVYSCDQERQSALEEAQQNPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPL    211 - 280
PGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRF    281 - 350
SEPDPSHTLEERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE    351 - 420
LKGCLGVSKEGRLV                                                            421 - 434
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23646827 2013 Mutations in ALDH1A3 cause microphthalmia.
23274784 2013 IL-17A but not IL-22 suppresses the replication of hepatitis B virus mediated by over-expression of MxA and OAS mRNA in the HepG2.2.15 cell line.
23263445 2013 Genetic association suggests that SMOC1 mediates between prenatal sex hormones and digit ratio.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21750680 2011 Loss of the BMP antagonist, SMOC-1, causes Ophthalmo-acromelic (Waardenburg Anophthalmia) syndrome in humans and mice.
21349332 2011 SMOC1 is a tenascin-C interacting protein over-expressed in brain tumors.
More...