Property Summary

NCBI Gene PubMed Count 25
PubMed Score 30.05
PubTator Score 37.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 9.9e-55
osteosarcoma 7950 6.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.005 6.8e-04
psoriasis -1.200 9.9e-55

Synonym

Accession Q9H479
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

AA Sequence

MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLEALRSTGLVRV      1 - 70
PRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREKLKEEENTVGRRGEGAEPQYV     71 - 140
DKFGFHTVTCCGFIPQVNEWQDDWPTFFARHRLQAQLDLIEKDYADREARELWSRLQVKIPDLFCGLEIV    141 - 210
PALLHGDLWSGNVAEDDVGPIIYDPASFYGHSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLY    211 - 280
QLFNYLNHWNHFGREYRSPSLGTMRRLLK                                             281 - 309
//

Text Mined References (26)

PMID Year Title