Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $14,334.5
PubMed Score 21.55
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession Q9H477 A9UK04 B4DV96 RK
Symbols RK
RBSK

Gene

PANTHER Protein Class (3)

 Grant Application (1)

PDB

2FV7   5BYC   5BYD   5BYE   5BYF   5C3Y   5C3Z   5C40   5C41  

Gene RIF (3)

PMID Text
25749547 Asn199 and Glu202 play an important role in the regulation of human ribokinase activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17585908 Identification and characterization of human ribokinase.

AA Sequence

MAASGEPQRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTS      1 - 70
MVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAA     71 - 140
NVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLT    141 - 210
VGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLA    211 - 280
YYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLF                                281 - 322
//

Text Mined References (10)

PMID Year Title
25749547 2015 Role of monovalent and divalent metal cations in human ribokinase catalysis and regulation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17585908 2007 Identification and characterization of human ribokinase and comparison of its properties with E. coli ribokinase and human adenosine kinase.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8382990 1993 Convergent evolution of similar enzymatic function on different protein folds: the hexokinase, ribokinase, and galactokinase families of sugar kinases.