Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.04
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.163 5.4e-03
astrocytic glioma -1.200 2.7e-02
nasopharyngeal carcinoma -1.200 1.1e-05
osteosarcoma -1.800 2.5e-08
pancreatic ductal adenocarcinoma liver m... -1.544 4.2e-03
posterior fossa group B ependymoma 1.500 6.6e-06
spina bifida -1.608 4.8e-02
tuberculosis -1.200 1.1e-06
ulcerative colitis -1.100 9.0e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MAASGEPQRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTS      1 - 70
MVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIVAGANLLLNTEDLRAAA     71 - 140
NVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLT    141 - 210
VGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTTGAGDSFVGALAFYLA    211 - 280
YYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTLF                                281 - 322
//

Text Mined References (10)

PMID Year Title