Property Summary

NCBI Gene PubMed Count 9
Grant Count 33
R01 Count 7
Funding $7,502,498.33
PubMed Score 25.73
PubTator Score 25.99

Knowledge Summary

Patent (1,007)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.100 0.003

AA Sequence

MRRPSVRAAGLVLCTLCYLLVGAAVFDALESEAESGRQRLLVQKRGALRRKFGFSAEDYRELERLALQAE      1 - 70
PHRAGRQWKFPGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNAVVRRLL     71 - 140
LAAKCCLGLRWTCVSTENLVVAGLLACAATLALGAVAFSHFEGWTFFHAYYYCFITLTTIGFGDFVALQS    141 - 210
GEALQRKLPYVAFSFLYILLGLTVIGAFLNLVVLRFLVASADWPERAARPPSPRPPGAPESRGLWLPRRP    211 - 280
ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI                        281 - 330
//

Text Mined References (10)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16382106 2005 International Union of Pharmacology. LV. Nomenclature and molecular relationships of two-P potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11749039 2001 Expression pattern in brain of TASK-1, TASK-3, and a tandem pore domain K(+) channel subunit, TASK-5, associated with the central auditory nervous system.
11680614 2001 TASK-5, a novel member of the tandem pore K+ channel family.
11431495 2001 KT3.2 and KT3.3, two novel human two-pore K(+) channels closely related to TASK-1.
11409881 2001 TASK-5, a new member of the tandem-pore K(+) channel family.