Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.81
PubTator Score 25.99

Knowledge Summary

Patent (1,007)

TINX Plot

  Disease (3)

Disease Target Count P-value
breast carcinoma 1638 3.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Gingival recession 13 3.613 1.8
Cocaine Dependence 51 3.278 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
breast carcinoma 1.100 3.3e-03

AA Sequence

MRRPSVRAAGLVLCTLCYLLVGAAVFDALESEAESGRQRLLVQKRGALRRKFGFSAEDYRELERLALQAE      1 - 70
PHRAGRQWKFPGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNAVVRRLL     71 - 140
LAAKCCLGLRWTCVSTENLVVAGLLACAATLALGAVAFSHFEGWTFFHAYYYCFITLTTIGFGDFVALQS    141 - 210
GEALQRKLPYVAFSFLYILLGLTVIGAFLNLVVLRFLVASADWPERAARPPSPRPPGAPESRGLWLPRRP    211 - 280
ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI                        281 - 330
//

Text Mined References (10)

PMID Year Title