Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.87817604532947E-20
non-small cell lung cancer 2798 5.43821521354631E-19
lung adenocarcinoma 2714 4.45601510014789E-18
posterior fossa group B ependymoma 1530 2.73676451257875E-13
cystic fibrosis 1670 5.42279907881275E-8
breast carcinoma 1614 1.73389325424662E-6
group 4 medulloblastoma 1875 1.43428020975006E-4
ovarian cancer 8492 0.00129878139152845
primary pancreatic ductal adenocarcinoma 1271 0.0116126671955906

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 0.000
cystic fibrosis -3.514 0.000
primary pancreatic ductal adenocarcinoma 1.033 0.012
non-small cell lung cancer -1.259 0.000
breast carcinoma -1.300 0.000
lung adenocarcinoma -1.500 0.000
group 4 medulloblastoma -1.400 0.000
lung carcinoma -2.000 0.000
ovarian cancer 1.400 0.001

Synonym

Accession Q9H425 A8K8R8 B3KTW1 G5EA08
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Xenopus OMA EggNOG Inparanoid

AA Sequence

MASMAAAIAASRSAVMSGNRPLDDRERKRFTYFSSLSPMARKIMQDKEKIREKYGPEWARLPPAQQDEII      1 - 70
DRCLVGPRAPAPRDPGDSEELTRFPGLRGPTGQKVVRFGDEDLTWQDEHSAPFSWETKSQMEFSISALSI     71 - 140
QEPSNGTAASEPRPLSKASQGSQALKSSQGSRSSSLDALGPTRKEEEASFWKINAERSRGEGPEAEFQSL    141 - 210
TPSQIKSMEKGEKVLPPCYRQEPAPKDREAKVERPSTLRQEQRPLPNVSTERERPQPVQAFSSALHEAAP    211 - 280
SQLEGKLPSPDVRQDDGEDTLFSEPKFAQVSSSNVVLKTGFDFLDNW                           281 - 327
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...