Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma -1.300 1.7e-06
cystic fibrosis -3.514 5.4e-08
ependymoma 1.800 1.6e-02
group 4 medulloblastoma -1.400 1.4e-04
lung adenocarcinoma -1.200 4.7e-14
lung carcinoma -2.000 4.9e-20
non-small cell lung cancer -1.259 5.4e-19
ovarian cancer 1.400 1.3e-03
primary pancreatic ductal adenocarcinoma 1.033 1.2e-02

AA Sequence

MASMAAAIAASRSAVMSGNRPLDDRERKRFTYFSSLSPMARKIMQDKEKIREKYGPEWARLPPAQQDEII      1 - 70
DRCLVGPRAPAPRDPGDSEELTRFPGLRGPTGQKVVRFGDEDLTWQDEHSAPFSWETKSQMEFSISALSI     71 - 140
QEPSNGTAASEPRPLSKASQGSQALKSSQGSRSSSLDALGPTRKEEEASFWKINAERSRGEGPEAEFQSL    141 - 210
TPSQIKSMEKGEKVLPPCYRQEPAPKDREAKVERPSTLRQEQRPLPNVSTERERPQPVQAFSSALHEAAP    211 - 280
SQLEGKLPSPDVRQDDGEDTLFSEPKFAQVSSSNVVLKTGFDFLDNW                           281 - 327
//

Text Mined References (12)

PMID Year Title