Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.88
PubTator Score 1.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.600 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.400 0.000
pancreatic ductal adenocarcinoma liver m... 1.726 0.001
lung cancer -1.500 0.044
interstitial cystitis -1.300 0.002
spina bifida -1.609 0.048
invasive ductal carcinoma 1.100 0.002
ovarian cancer 1.900 0.000
pancreatic cancer 1.100 0.036

AA Sequence

MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMAT      1 - 70
VLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS                               71 - 114
//

Text Mined References (5)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.