Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.88
PubTator Score 1.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 4.1e-05
glioblastoma 1.400 1.1e-05
interstitial cystitis -1.300 1.7e-03
invasive ductal carcinoma 1.100 2.2e-03
lung cancer -1.500 4.4e-02
ovarian cancer 1.200 4.8e-05
pancreatic cancer 1.100 3.6e-02
pancreatic ductal adenocarcinoma liver m... 1.726 6.4e-04
psoriasis -1.600 1.7e-04
spina bifida -1.609 4.8e-02

Synonym

Accession Q9H3Y8 E1P5J2 Q4VXP1 Q9H3Y7
Symbols exdpf
C20orf149
dJ697K14.9

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMAT      1 - 70
VLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS                               71 - 114
//

Text Mined References (6)

PMID Year Title