Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.88
PubTator Score 1.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.07492701242162E-6
glioblastoma 5572 1.06928367602233E-5
atypical teratoid / rhabdoid tumor 4369 4.05728458948447E-5
psoriasis 6685 1.72669926135028E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.4178242145677E-4
interstitial cystitis 2299 0.00165208069614027
invasive ductal carcinoma 2950 0.0021974968724978
pancreatic cancer 2300 0.0360052029704013
lung cancer 4473 0.0436682973091184
spina bifida 1064 0.0478953862581784

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.600 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
glioblastoma 1.400 0.000
pancreatic ductal adenocarcinoma liver m... 1.726 0.001
lung cancer -1.500 0.044
interstitial cystitis -1.300 0.002
spina bifida -1.609 0.048
invasive ductal carcinoma 1.100 0.002
ovarian cancer 1.900 0.000
pancreatic cancer 1.100 0.036

Synonym

Accession Q9H3Y8 E1P5J2 Q4VXP1 Q9H3Y7
Symbols exdpf
C20orf149
dJ697K14.9

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

AA Sequence

MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMAT      1 - 70
VLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS                               71 - 114
//

Text Mined References (5)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.